Robuta

https://elifesciences.org/articles/43154 Collider bias and the apparent protective effect of glucose-6-phosphate dehydrogenase deficiency on... Selection bias, also known as collider bias, likely explains the apparent protective effect of G6PD deficiency against cerebral falciparum malaria. https://www.b12alliancewestminster.org.uk/ B12 Alliance Parliamentary Reception Westminster | Vitamin B12 Deficiency UK The B12 Alliance Parliamentary Reception at Westminster 2026 unites MPs, clinicians, researchers and patient advocates to advance vitamin B12 deficiency... parliamentary receptionvitamin deficiencyalliancewestminsteruk https://transfusionnews.com/2026/01/14/ferritin-guided-donation-policies-decrease-iron-deficiency/ Ferritin-Guided Donation Policies Decrease Iron Deficiency - Transfusion News Jan 14, 2026 - Most blood establishments monitor hemoglobin (Hb) levels to prevent anemia, but Hb monitoring does not protect against iron deficiency (ID).... donation policiesiron deficiencyferritinguideddecrease https://glut1deficiency.org.uk/ Glut1 Deficiency Glut1 Deficiency UK is a non-profit family led charity dedicated to improving the lives of those in the Glut1 Deficiency community. deficiency https://www.aging-us.com/article/202591/text Examining sleep deficiency and disturbance and their risk for incident dementia and all-cause... Background: Sleep disturbance and deficiency are common among older adults and have been linked with dementia and all-cause mortality. Using nationally... https://nutrient.tech/ Nutrient TECH Foliar Nutrient Sprays | Crop Nutritional Deficiency foliar spraysnutrienttechcropnutritional https://www.aafp.org/afp/2022/0800/fpin-ci-iron-deficiency-anemia Intravenous Iron vs. Oral Iron in Iron Deficiency Anemia | AFP Is intravenous iron infusion superior to oral iron for avoiding blood transfusion in adults with iron deficiency anemia? intravenousironvsoraldeficiency https://ub01.uni-tuebingen.de/xmlui/handle/10900/79161 3-Hydroxy-3-methylglutaryl-coenzyme A lyase deficiency: Clinical presentation and outcome in a... https://foodsystems.uw.edu/project/11206/ Exploring the Role of High School Athletic Trainers in Relative Energy Deficiency in Sport and... School of Public Health https://researchportalplus.anu.edu.au/en/publications/deficiency-in-th2-cytokine-responses-exacerbate-orthopoxvirus-inf/fingerprints/ Deficiency in Th2 Cytokine Responses Exacerbate Orthopoxvirus Infection - Fingerprint - The... deficiencycytokineresponsesorthopoxvirusinfection https://crops.extension.iastate.edu/encyclopedia/potassium-deficiency-symptoms-corn-and-soybean-what-can-we-do-about-them Potassium deficiency symptoms in corn and soybean: What can we do about them? | Integrated Crop... https://pmc.ncbi.nlm.nih.gov/articles/PMC4878686/ Nursing home deficiency citations for safety - PMC Deficiency citations for safety violations in U.S. nursing homes from 2000 to 2007 are examined (representing a panel of 119,472 observations). Internal (i.e.,... nursing homefor safetydeficiencycitationspmc https://scholars.duke.edu/publication/1470532 Scholars@Duke publication: Hemodynamic Response to Treatment of Iron Deficiency Anemia in Pulmonary... https://medlineplus.gov/genetics/condition/beta-ketothiolase-deficiency/ Beta-ketothiolase deficiency: MedlinePlus Genetics Beta-ketothiolase deficiency is an inherited disorder in which the body cannot effectively process a protein building block ( amino acid ) called isoleucine.... betadeficiencymedlineplusgenetics https://prism.northwestern.edu/records/dcty5-g9c98 Iron Deficiency and Stroke iron deficiencystroke https://epub.ub.uni-muenchen.de/86684/ Natural history study of factor IX deficiency with focus on treatment and complications (B-Natural) natural history study https://bibliographie.uni-tuebingen.de/xmlui/handle/10900/97474 SERAC1 deficiency causes complicated HSP: evidence from a novel splice mutation in a large family https://pubmed.ncbi.nlm.nih.gov/21550088/ Vitamin D deficiency is common and associated with metabolic risk factors in patients with... Both vitamin D deficiency and polycystic ovary syndrome (PCOS) are associated with aspects of metabolic syndrome, but it is unclear whether vitamin D... vitamin d deficiency https://www.mdpi.com/2072-6643/9/4/340 Plasma Vitamin D Deficiency Is Associated With Poor Sleep Quality and Night-Time Eating at... Plasma 25-hydroxyvitamin D (25OHD) deficiency, poor sleep quality, and night-time eating, have been independently associated with adverse pregnancy outcomes,... https://pubmed.ncbi.nlm.nih.gov/40263631/ Global, regional and national burden of dietary iron deficiency from 1990 to 2021: a Global Burden... Although iron deficiency is well documented, less is known about dietary involvement in symptomatic iron deficiency manifesting in medical conditions. In this... https://profiles.nlm.nih.gov/spotlight/ncaids/catalog?f%5Breadonly_creator_ssim%5D%5B%5D=United+States.+National+Commission+on+Acquired+Immune+Deficiency+Syndrome&page=3&view=masonry Creator: United States. National Commission on Acquired Immune Deficiency Syndrome - National... united statesimmune deficiencycreatornationalcommission https://pubmed.ncbi.nlm.nih.gov/38238601/ Gpcpd1-GPC metabolic pathway is dysfunctional in aging and its deficiency severely perturbs glucose... Skeletal muscle plays a central role in the regulation of systemic metabolism during lifespan. With aging, this function is perturbed, initiating multiple... https://www.ipmc.cnrs.fr/fr/publication/fmr1-deficiency-impacts-body-composition-skeleton-and-bone-microstructure-in-a-mouse-model-of-fragile-x-syndrome/ Fmr1-Deficiency Impacts Body Composition, Skeleton, and Bone Microstructure in a Mouse Model of... https://pubmed.ncbi.nlm.nih.gov/24737826/ Diagnostic criteria for constitutional mismatch repair deficiency syndrome: suggestions of the... Constitutional mismatch repair deficiency (CMMRD) syndrome is a distinct childhood cancer predisposition syndrome that results from biallelic germline... diagnostic criteriamismatch repairconstitutional https://www.indiatimes.com/health/recipes/add-this-tasty-chilled-beetroot-soup-to-your-diet-and-bid-your-iron-deficiency-goodbye/articleshow/122591425.html Add this tasty chilled beetroot soup to your diet and bid your iron deficiency goodbye This chilled beetroot soup is a delicious way of incorporating beetroots into your diet that will not only make your iron deficiency go away but also give a... https://discovery.fiu.edu/display/pub287060 Alpha-1 antitrypsin deficiency and pregnancy complications and birth outcomes: A population-based... pregnancy complications https://structure.bmc.lu.se/idbase/IDRefSeq/xml/idr/ff/FF1297a06.html?style=OR Fact file for GFI1 deficiency fact filedeficiency https://bmcdev-e2b2a6gdfff3f6d0.uaenorth-01.azurewebsites.net/diseases/rickets-and-vitamin-d-deficiency/ Rickets and vitamin D deficiency - Burjeel Medical City vitamin d deficiencyricketsmedicalcity https://researchportal.helsinki.fi/sv/publications/the-higher-frequency-of-iga-deficiency-among-swedish-twins-is-not/ The higher frequency of IgA deficiency among Swedish twins is not explained by HLA haplotypes -... https://open.library.emory.edu/concern/publications/4e12af77-b8aa-4f72-adb4-4392a0e7d5a1 Hepatocyte-specific Nrf2 deficiency mitigates high-fat diet-induced hepatic steatosis: Involvement... Hepatocyte-specific Nrf2 deficiency mitigates high-fat diet-induced hepatic steatosis: Involvement of reduced PPAR gamma expression high fat diet https://rarediseases.info.nih.gov/diseases/13639/deficiency-of-udpglucose-hexose-1-phosphate-uridylyltransferase Deficiency of UDPglucose-hexose-1-phosphate uridylyltransferase | About the Disease | GARD Find symptoms and other information about Deficiency of UDPglucose-hexose-1-phosphate uridylyltransferase. about the diseasedeficiency https://www.sciencenews.org/article/enough-isnt-enough-epidemic-vitamin-d-deficiency Enough Isn't Enough: An epidemic of vitamin D deficiency Aug 8, 2019 - Many U.S. women of childbearing age, particularly those of African descent, lack sufficient vitamin D even though they consume the recommended amount. vitamin denoughepidemicdeficiency https://timesofindia.indiatimes.com/life-style/health-fitness/health-news/high-blood-pressure-and-muscle-twitches-6-common-issues-caused-by-magnesium-deficiency/articleshow/120964836.cms Magnesium Deficiency: High Blood Pressure and muscle twitches: 6 common issues caused by magnesium... Discover how magnesium deficiency can lead to serious health issues like high blood pressure, muscle twitches, and mental health disorders. Learn the... high blood pressure https://view-health-screening-recommendations.service.gov.uk/biotinidase-deficiency/ Biotinidase deficiency - UK National Screening Committee (UK NSC) - GOV.UK biotinidase deficiencyuk nationalscreening committeensc https://ec2-54-210-179-21.compute-1.amazonaws.com/compliance/articles/2306091/deficiency-trends-in-national-futures-association-exams Deficiency Trends In National Futures Association Exams - Law360 A recent notice from the National Futures Association outlining the most common deficiencies uncovered during exams gives member firms an opportunity to review... national futures associationdeficiencytrendsexams https://scholars.uky.edu/es/publications/lpa-receptor-4-deficiency-attenuates-experimental-atherosclerosis/ LPA receptor 4 deficiency attenuates experimental atherosclerosis - lpa receptordeficiencyexperimentalatherosclerosis https://pubmed.ncbi.nlm.nih.gov/10356662/ Carnitine deficiency and hyperammonemia in children receiving valproic acid with and without other... Plasma ammonia and total and free carnitine were measured in 84 children requiring anticonvulsant drugs: 32 patients (group A) on valproic acid alone, 28... carnitine deficiency https://hospitality.economictimes.indiatimes.com/news/speaking-heads/indias-protein-gap-why-access-to-high-quality-protein-is-now-a-public-health-priority/130847003 Addressing India's Protein Deficiency: A Public Health Crisis, ETHospitalityWorld Indias: India faces a significant protein gap affecting health and development. This article explores the nutritional challenges, the importance of... public health crisisaddressingindiaproteindeficiency https://www.ncbi.nlm.nih.gov/clinvar/RCV001271415/ NM_022132.5(MCCC2):c.1690TC (p.Ter564Gln) AND Methylcrotonyl-CoA carboxylase deficiency - ClinVar... ClinVar archives and aggregates information about relationships among variation and human health. https://www.frontiersin.org/journals/nutrition/articles/10.3389/fnut.2023.1249402/full Frontiers | Vitamin D deficiency prevention policies in Iran: a retrospective policy analysis The prevalence of vitamin D deficiency (VDD) in Iran has been reported higher than the global level. This study aimed to assess VDD prevention policies in Ir... vitamin d deficiency https://doctor.ndtv.com/faq/how-to-treat-vitamin-b-deficiency-beri-beri-8965 How to treat vitamin B deficiency (beri beri)? how to treatvitamin bdeficiencyberi https://profiles.nlm.nih.gov/spotlight/ncaids/catalog?f%5Breadonly_creator_ssim%5D%5B%5D=United+States.+National+Commission+on+Acquired+Immune+Deficiency+Syndrome&sort=readonly_title_ssim+desc&view=slideshow Creator: United States. National Commission on Acquired Immune Deficiency Syndrome - National... united statesimmune deficiencycreatornationalcommission https://pmc.ncbi.nlm.nih.gov/articles/PMC8377140/ Relation between vitamin D deficiency and benign paroxysmal positional vertigo - PMC Benign paroxysmal positional vertigo (BPPV) is the most common cause of positional vertigo. Vitamin D deficiency may be one of the causes of its development.... vitamin d deficiencyrelation https://profiles.nlm.nih.gov/spotlight/ncaids/catalog?f%5Breadonly_creator_ssim%5D%5B%5D=United+States.+National+Commission+on+Acquired+Immune+Deficiency+Syndrome&per_page=10&sort=relevance&view=list Creator: United States. National Commission on Acquired Immune Deficiency Syndrome - National... united statesimmune deficiencycreatornationalcommission https://commons.case.edu/facultyworks/1010/ "Kindlin-3 Deficiency leads to Impaired Erythropoiesis and Erythrocyte " by Chloe Turpin, Utku... Kindlin-3 (K3) is critical for the activation of integrin adhesion receptors in hematopoietic cells. In humans and mice, K3 deficiency is associated with... https://structure.bmc.lu.se/idbase/IDRefSeq/xml/idr/ff/FF137a06.html?style=OR Fact file for RFX-5, MHCII promoter X box regulatory factor 5 deficiency fact file https://pmc.ncbi.nlm.nih.gov/articles/PMC39903/ Long-term in vitro correction of alpha-L-iduronidase deficiency (Hurler syndrome) in human bone... Allogeneic bone marrow transplantation is the most effective treatment for Hurler syndrome but, since this therapy is not available to all patients, we have... https://researchconnect.buffalo.edu/en/publications/carnitine-palmitoyl-transferase-deficiency-in-a-university-immuno/ Carnitine Palmitoyl Transferase Deficiency in a University Immunology Practice - SUNY University at... in acarnitinetransferasedeficiency https://pubmed.ncbi.nlm.nih.gov/24810877/ Two infants with infantile spasms associated with vitamin B12 deficiency We suggest that vitamin B12 deficiency should be considered in the differential diagnosis of infantile spasms as a treatable cause, especially with a history... infantile spasmstwoinfantsassociatedvitamin https://nrc-publications.canada.ca/eng/view/object/?id=60120282-8ce1-494d-805b-b95ee4ab9424 Deficiency of the chromatin regulator Brpf1 causes abnormal brain development - NRC Publications... Deficiency of the chromatin regulator Brpf1 causes abnormal brain development of the https://app-stadare-prod-uks-frontend.azurewebsites.net/cetebe-stada-cti-digital/cetebe-vitamin-d-deficiency-quiz Cetebe Vitamin D Deficiency Quiz | Cetebe Master vitamin d deficiencycetebequizmaster https://en.iz.ru/en/1990004/2025-11-14/erikenovas-doctor-named-main-symptoms-vitamin-d-deficiency Erikenova's doctor named the main symptoms of vitamin D deficiency | News | Izvestia | 13.11.2025 Nov 14, 2025 - Vitamin D deficiency can be manifested by fatigue, muscle weakness, depression, and frequent acute respiratory viral infections. She told the Newspaper about... https://research-repository.uwa.edu.au/en/publications/color-vision-deficiency-datasets-amp-recoloring-evaluation-using-/ Color vision deficiency datasets & recoloring evaluation using GANs - the UWA Profiles and Research... https://pmc.ncbi.nlm.nih.gov/articles/PMC5348436/ Growth hormone replacement therapy reduces risk of cancer in adult with growth hormone deficiency:... The risk of growth hormone on cancer in adult with growth hormone deficiency remains unclear. We carried out a meta-analysis to evaluate the risk of cancer in... hormone replacement therapyreduces risk https://pubmed.ncbi.nlm.nih.gov/?term=%22ZAP-70+deficiency%22 "ZAP-70 deficiency" - Search Results - PubMed "ZAP-70 deficiency" - Search Results - PubMed search resultszapdeficiencypubmed https://www.wikidata.org/wiki/Q52078740 18q deletion syndrome in a child with steroid-17,20-lyase deficiency - Wikidata scientific article published in June 1986 https://www.mdpi.com/2072-6643/13/3/849 Re-Defining the Population-Specific Cut-Off Mark for Vitamin A Deficiency in Pre-School Children of... Retinol Binding Protein (RBP) is responsible for the transport of serum retinol (SR) to target tissue in the body. Since RBP is relatively easy and cheap to... https://ub01.uni-tuebingen.de/xmlui/handle/10900/136108?show=full Validated biomarker assays confirm that ARID1A loss is confounded with MMR deficiency, CD8(+) TIL... https://dbbs.wustl.edu/events/event/speaker-kendall-burks-effects-of-angptl3-deficiency-on-the-regulation-of-hepatic-lipoprotein-production-and-lipid-metabolism/ Speaker: Kendall Burks - "Effects of ANGPTL3 Deficiency on the Regulation of Hepatic Lipoprotein... https://www.wikidata.org/wiki/Q64388338 Deficiency in the repair of DNA damage by homologous recombination and sensitivity to... article by Nuala McCabe et al published 15 August 2006 in Cancer Research https://www.nhlbi.nih.gov/health/anemia/iron-deficiency-anemia Anemia - Iron-Deficiency Anemia | NHLBI, NIH Iron-deficiency anemia develops if you do not have enough iron in your body. Learn about the causes, symptoms, and treatments for iron-deficiency anemia. anemia iron deficiencynhlbinih https://collaborate.princeton.edu/en/publications/immunopathological-and-microbial-signatures-of-inflammatory-bowel/ Immunopathological and microbial signatures of inflammatory bowel disease in partial RAG deficiency... inflammatory bowel disease https://profiles.nlm.nih.gov/spotlight/ncaids/catalog?f%5Breadonly_creator_ssim%5D%5B%5D=United+States.+National+Commission+on+Acquired+Immune+Deficiency+Syndrome&page=1&per_page=10&view=slideshow Creator: United States. National Commission on Acquired Immune Deficiency Syndrome - National... united statesimmune deficiencycreatornationalcommission https://library.wur.nl/ojs/index.php/njas/article/view/17189 Comparative response to nitrogen deficiency of a tropical and temperate grass in the interrelation... https://ankhrahhq.blogspot.com/2017/04/everyday-symptoms-that-indicate-vitamin.html Ankh Rah's Healthy Living Guide: Everyday Symptoms that Indicate a Vitamin or Mineral Deficiency! This natural food supplement co. cares about your health. Join our Healthy Living Soc., receive newsletters, eBooks, coupons for Ankh Rah supplements https://www.cirm.ca.gov/cirm-trial/clinical-study-of-dtx301-aav-mediated-gene-transfer-for-ornithine-transcarbamylase-otc-deficiency-2/ Clinical Study of DTX301 AAV-Mediated Gene Transfer for Ornithine Transcarbamylase (OTC) Deficiency... https://www.propublica.org/article/vitamin-k-baby-autopsy-reports What I Learned About Vitamin K Deficiency From Babies’ Autopsy Reports — ProPublica Babies have died after not receiving the vitamin K shot at birth. Their autopsy records underscore how preventable their deaths could have been. what i learnedvitamin k deficiency https://pubmed.ncbi.nlm.nih.gov/12486872/ Molecular study of electron transfer flavoprotein alpha-subunit deficiency in two Japanese children... These four mutations were pathogenic for GAII and missense mutations, alpha G255V and alpha G267R were considered anecdotal for mild and severe forms,... https://boris-portal.unibe.ch/entities/publication/7a956f48-1173-4c42-bb33-50533c160c78 Autosomal Cholesterol Deficiency in a Holstein Calf in aautosomalcholesteroldeficiencyholstein https://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2021.673487/full Frontiers | Case Report: Hypomorphic Function and Somatic Reversion in DOCK8 Deficiency in One... DOCK8 deficiency is a combined immunodeficiency due to biallelic variants in dedicator of cytokinesis 8 (DOCK8) gene. The disease has a wide clinical spectru... case report https://pubmed.ncbi.nlm.nih.gov/16880373/ Very long-chain acyl-CoA dehydrogenase deficiency presenting as acute hypercapnic respiratory... Very long-chain acyl-CoA dehydrogenase deficiency (VLCAD) is a key enzyme catalysing the dehydrogenation of long-chain fatty acids in mitochondrial... very long https://pure.psu.edu/en/publications/selenium-deficiency-alters-the-lipoxygenase-pathway-and-mitogenic/ Selenium deficiency alters the lipoxygenase pathway and mitogenic response in bovine lymphocytes -... selenium deficiency https://smallgrains.ces.ncsu.edu/magnesium-deficiency-of-carinata/ Magnesium Deficiency of Carinata - Small Grains | NC State Extension May 31, 2018 - From the Field - Agronomy Notes In this Brassica carinata (Ethiopian Mustard) research update, we highlight the symptoms of magnesium deficiency. These images... magnesium deficiencysmall grainscarinatastateextension https://www.businesswire.com/news/home/20221124005079/en/Iron-Deficiency-Day-2022-CSL-Vifor-calls-to-take-iron-seriously Iron Deficiency Day 2022: CSL Vifor calls to take iron seriously Regulatory News: Tomorrow is Iron Deficiency Day. For the eighth consecutive year, CSL Vifor is supporting a growing alliance of international organizations ... iron deficiencycsl vifordaycallstake https://scholars.okstate.edu/en/publications/pseudothrombotic-microangiopathy-and-vitamin-b12-deficiency-in-pe/fingerprints/ Pseudothrombotic Microangiopathy and Vitamin B12 Deficiency in Pernicious Anemia - Fingerprint -... pernicious anemiavitamindeficiencyfingerprint https://profiles.nlm.nih.gov/spotlight/ncaids/catalog?f%5Breadonly_creator_ssim%5D%5B%5D=United+States.+National+Commission+on+Acquired+Immune+Deficiency+Syndrome&page=2&sort=readonly_date-yyyymmdd_ssim+desc Creator: United States. National Commission on Acquired Immune Deficiency Syndrome - National... united statesimmune deficiencycreatornationalcommission https://pubmed.ncbi.nlm.nih.gov/40414757/ [Acid sphingomyelinase deficiency: A review] Acid sphingomyelinase deficiency, formerly known as Niemann-Pick disease types B, A/B, and B, is a rare genetic disorder. It is an inherited autosomal... aciddeficiencyreview https://pure.psu.edu/en/publications/a-novel-combination-of-compound-heterozygous-variants-in-ifngr1-c/ A Novel Combination of Compound Heterozygous Variants in IFNGR1 Causing Complete IFNGR1 Deficiency... a novel https://ruggedconditioning.libsyn.com/e29-miriam-overcoming-surgery-mishaps-b12-deficiency-and-a-workplace-bully Trail Running Women: E29 Miriam: Overcoming surgery mishaps, B12 deficiency, and a workplace bully Miriam is a 60 year old runner that has survived 4 surgeries, Cipro toxicity, and B12 deficiency. She credits running for her ability to make it through a... https://pubmed.ncbi.nlm.nih.gov/32558936/ SMARCB1 loss induces druggable cyclin D1 deficiency via upregulation of MIR17HG in atypical... Atypical teratoid rhabdoid tumor (ATRT) is a fatal pediatric malignancy of the central neural system lacking effective treatment options. It belongs to the... https://pubmed.ncbi.nlm.nih.gov/40613642/ Evaluation of coagulation disorders and iron deficiency in women with heavy menstrual bleeding Laboratory screening in a large series of women with HMB disclosed potential CBD in almost 10% of them and overt or rampant anemia in at least 40%. These... https://www.cordis.europa.eu/project/id/101038072/results/it N fixing bacteria from extreme environments as a remedy for nitrogen deficiency in saline soils |... Deliverables, publications, datasets, software, exploitable results https://pubmed.ncbi.nlm.nih.gov/39149363/ Neurofibromin deficiency alters the patterning and prioritization of motor behaviors in a... Genetic disorders such as neurofibromatosis type 1 increase vulnerability to cognitive and behavioral disorders, such as autism spectrum disorder and... https://pubmed.ncbi.nlm.nih.gov/31220970/ Hepcidin as a diagnostic biomarker of iron deficiency anemia during pregnancy 24012018-1 on 24 January 2018. iron deficiency anemiahepcidindiagnosticbiomarker https://www.mendeley.com/catalogue/1b36055a-ddbc-34df-b0f5-c1761eda84b8/ Hsp22 deficiency induces age-depe... preview & related info | Mendeley (2021) Wu et al. Antioxidants. Heat shock protein 22 (Hsp22) is a small heat shock protein predominantly expressed in skeletal and cardiac muscle. Previous... related infodeficiencyagedepepreview https://profiles.nlm.nih.gov/spotlight/ncaids/catalog?f%5Breadonly_creator_ssim%5D%5B%5D=United+States.+National+Commission+on+Acquired+Immune+Deficiency+Syndrome&page=2&per_page=50&sort=readonly_date-yyyymmdd_ssim+desc&view=masonry Creator: United States. National Commission on Acquired Immune Deficiency Syndrome - National... united statesimmune deficiencycreatornationalcommission https://pure.psu.edu/en/publications/a-postweaning-iron-adequate-diet-following-neonatal-iron-deficien/ A postweaning iron-adequate diet following neonatal iron deficiency affects iron homeostasis and... ironadequatediet https://oru.diva-portal.org/smash/record.jsf?faces-redirect=true&language=en&searchType=SIMPLE&query=&af=%5B%5D&aq=%5B%5B%5D%5D&aq2=%5B%5B%5D%5D&aqe=%5B%5D&pid=diva2%3A804992&noOfRows=50&sortOrder=author_sort_asc&sortOrder2=title_sort_asc&onlyFullText=false&sf=all IgA Deficiency and Risk of Cancer : A Population-Based Matched Cohort Study iga deficiency https://umu.diva-portal.org/smash/record.jsf?pid=diva2:1148713 A Paleolithic-type diet results in iodine deficiency : a 2-year randomized trial in postmenopausal... https://boris-portal.unibe.ch/entities/publication/8149241d-74dd-47fc-915c-1a4b348922cf Hypoglycemia despite hyperglycemia. Is a cerebral glucose deficiency possible even with raised... Hypoglycemia represents the most frequent endocrinologic emergency situation in prehospital patient care. As the patients are usually unconscious on arrival of... is a https://www.cambridge.org/core/journals/public-health-nutrition/article/prevalence-of-vitamin-b12-depletion-and-deficiency-in-liechtenstein/71A9FCAF3E5D35E01C6FFB6E1BF450BB Prevalence of vitamin B12 depletion and deficiency in Liechtenstein | Public Health Nutrition |... Prevalence of vitamin B12 depletion and deficiency in Liechtenstein - Volume 17 Issue 2 https://pubmed.ncbi.nlm.nih.gov/31752029/ Recurrent Demyelinating Episodes as Sole Manifestation of Inherited CD59 Deficiency Defects in the regulatory components of the complement system can lead to inflammatory diseases. We present a patient who had four episodes of demyelination in... recurrentepisodessolemanifestationinherited https://pubmed.ncbi.nlm.nih.gov/37217097/ Does maternal genetic liability to folate deficiency influence the risk of antiseizure... In this cohort of pregnant women reporting widespread use of folic acid supplements, maternal genetic liability to folate deficiency did not significantly... folate deficiency https://www.news-medical.net/news/20251110/New-dietary-supplement-may-efficiently-treat-iron-deficiency-and-anemia.aspx New dietary supplement may efficiently treat iron deficiency and anemia Nov 10, 2025 - Iron deficiency is globally widespread. Women are particularly affected, with one in five in Europe suffering from iron deficiency. dietary supplementiron deficiencynewmayefficiently https://www.frontiersin.org/journals/endocrinology/articles/10.3389/fendo.2025.1512161/full Frontiers | Long-term outcomes of congenital adrenal hyperplasia due to 21-hydroxylase deficiency:... IntroductionData on congenital adrenal hyperplasia (CAH) disorders in the Saudi population are limited. This retrospective study assessed the clinical charac... https://academiccommons.columbia.edu/doi/10.7916/D8W66S1D Helicobacter pylori infection and low dietary iron alter behavior, induce iron deficiency anemia,... Helicobacter pylori (H.pylori), a bacterial pathogen, is a causative agent of gastritis and peptic ulcer disease and is a strong risk factor for development of... helicobacter pylori infection https://profiles.nlm.nih.gov/spotlight/ncaids/catalog?f%5Breadonly_creator_ssim%5D%5B%5D=United+States.+National+Commission+on+Acquired+Immune+Deficiency+Syndrome&page=7&per_page=10&sort=readonly_date-yyyymmdd_ssim+desc&view=gallery Creator: United States. National Commission on Acquired Immune Deficiency Syndrome - National... united statesimmune deficiencycreatornationalcommission https://researchportalplus.anu.edu.au/en/publications/salinity-induced-potassium-deficiency-causes-loss-of-functional-p/ Salinity-induced potassium deficiency causes loss of functional photosystem II in leaves of the... https://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2018.00965/full Frontiers | Tespa1 Deficiency Dampens Thymus-Dependent B-Cell Activation and Attenuates... Thymocyte-expressed, positive selection-associated 1 (Tespa1) plays an important role in both T cell receptor (TCR)-driven thymocyte development and in the F... b cellfrontiersdeficiencythymus https://www.frontiersin.org/journals/endocrinology/articles/10.3389/fendo.2024.1485238/full Frontiers | The association between Vitamin D deficiency and clinical pregnancy rate in IVF... BackgroundThe aim of the present study was to investigate the impact of serum VD status on IVF outcomes and to observe the effect of VD deficiency on the exp... vitamin d deficiency