https://www.datadoghq.com/
See metrics from all of your apps, tools & services in one place with Datadog’s cloud monitoring as a service solution. Try it for free.
cloud monitoringservicedatadog
https://www.bestbackups.com/cma-targets-british-cloud-service-providers/
The Competition and Markets Authority is accusing British cloud service providers of not treating customers fairly, breaching consumer law.
cloud service providerscmatargetsbritishcom
https://sdtimes.com/softwaredev/pulumi-idp-provides-developers-with-faster-access-to-self-service-cloud-infrastructure-provisioning/
May 7, 2025 - Software Development News
self servicepulumiidpprovidesdevelopers
https://www.acecloudhosting.com/cyber-security/managed-security-services/soc-as-a-service/
Dec 10, 2025 - Managed SOC services provide 24/7/365 threat detection, incident response, and continuous expert monitoring to safeguard your business. Start securing your...
managed solutionssocservicegetace
https://www.alibabacloud.com/en/product/certificates?_p_lc=1
Efficiently manage SSL/TLS certificates with our Certificate Management Service for secure communications.
certificate managementalibaba cloudservice
https://www.centreon.com/centreon-cloud/
Nov 6, 2025 - Centreon Cloud is a SaaS IT monitoring solution that helps businesses ensure the availability and performance of their IT infrastructure.
infrastructure monitoringcentreoncloudservice
https://www.cloudsigma.com/
CloudSigma offers a unique fully managed cloud solution based on a revenue sharing business model. IT service providers around the globe are partnering with...
global networkcloudservicejoin
https://www.databricks.com/company/partners/cloud-partners
Databricks runs on every major public cloud, tightly integrated with the security, storage, analytics & AI services offered by Cloud Service Provider...
cloud service providerdatabrickspartner
https://www.acecloudhosting.com/cyber-security/managed-security-services/dns-filtering/
Dec 10, 2025 - Protect your network with the best DNS security service from Ace Cloud Hosting. Safeguard against cyber threats and ensure a secure online environment.
dns securityservice acecloud hostingbest
https://www.alibabacloud.com/en/product/sase?_p_lc=1
An office security management platform that integrates zero trust network access, office data protection, and terminal management.
secure accessalibaba cloudserviceedge
https://www.abiresearch.com/market-research/service/cloud
ABI Research’s Cloud Research Service guides providers and implementers across hybrid, sovereign, and neocloud domains, covering infrastructure trends,...
service cloud
https://www.secureax.com/?utm_source=website&utm_medium=banner&utm_campaign=microsoft
Aug 27, 2021 - SecureAX is a leading Web Email Cloud Managed Hosting in Singapore. Improve your cloud security with us. Large storage business email hosting
web emailcloud hostingservice provider
https://netnordicdenmark.dk/hvad-vi-gor/cloud/private-cloud/infrastructure-as-a-service/
May 20, 2025 - Infrastructure as a Service fra NetNordic giver dig privat cloud med servere, netværk og storage. Kontakt os for den rette løsning til jer.
infrastructureserviceprivatcloudtil
https://www.alibabacloud.com/en/product/anti-ddos?_p_lc=1
Alibaba Cloud Anti-DDoS Basic is a cloud-based security service safeguards your data and applications from DDoS and Trojan attacks, provides visibility and...
anti ddossecurity servicebasictrojanattacks
https://www.telehouse.net/data-centre-connectivity/cloud-connectivity-services/
Feb 14, 2024 - Telehouse's secure cloud connectivity services provide low-latency connectivity to major cloud service providers such as AWS with a 99.9999% redundancy.
secure cloudservice providerconnectivitytelehouse
https://www.alibabacloud.com/en/product/log-service?_p_lc=1
Alibaba Cloud Simple Log Service is an end-to-end real-time data logging service developed by Alibaba Group that has been tested in a large number of big data...
real timesimplelogserviceend
https://www.huaweicloud.com/intl/en-us/product/obs.html
Object Storage Service (OBS) provides secure, stable, and virtually infinite scalable object storage. You can store massive amounts of data on OBS.
object storagehuawei cloudserviceobs
https://www.gdata.at/business/security-services/verdict-as-a-service
Mehr Sicherheit für Ihre Daten ✓ in der Cloud Cloud Antivirus On Demand ✅ ohne lokale Installation ▶ Jetzt mehr erfahren!
g datacloudantivirusverdictservice
https://www.acecloudhosting.com/vdi/desktop-as-a-service/
Nov 20, 2025 - Get fast and secure cloud desktops for your team in minutes with desktop-as-a-service. Test drive DaaS solution today!
service acecloud hostingdesktop
https://www.datadoghq.com/ko/?lang_pref=ko
See metrics from all of your apps, tools & services in one place with Datadog’s cloud monitoring as a service solution. Try it for free.
cloud monitoringservicedatadog
https://www.schellman.com/blog/federal-compliance/fedramp-20x-impacts-to-csps
Schellman explains FedRAMP 20x changes and how they impact cloud service providers (CSPs) who are pursuing FedRAMP authorization and who already have it.
cloud service providersfedrampkeychangesimpacts
https://www.clickittech.com/cloud-security-service/
Jun 4, 2025 - Ensure robust data protection, continuous monitoring, threat detection, and compliance for cloud environments with our Cloud Security Services
cloud security serviceexpertclickit
https://vercara.digicert.com/
May 6, 2025 - Get premium DNS services from a leading DNS service provider. Vercara offers UltraDNS along with cloud-based security solutions for networks and web...
dns servicesecurity solutionsprovidercloudbased
https://www.alibabacloud.com/en/product/kubernetes?_p_lc=1
Alibaba Cloud Container Service for Kubernetes (ACK) provides enterprise-level high-performance and flexible management of Kubernetes containerized...
alibaba cloudcontainer servicekubernetesack
https://www.huaweicloud.com/intl/en-us/service/supportplans.html
HUAWEI CLOUD Support and Service Plans provide a unique combination of tools and expertise to help you do amazing things with HUAWEI CLOUD.
support planscustomer servicehuawei cloud
https://www.tixeo.com/solutions-de-visioconference-securisee-tixeo/service-de-visioconference-tixeocloud/
Dec 24, 2024 - TixeoCloud est une solution de visioconférence dans le Cloud de Tixeo dont le déploiement est simple, rapide et sécurisé.
servicecloudrapideamp
https://hitechcloud.vn/hi-techcloud-kubernetes-service-vks/
Jan 30, 2025 - HiTechCloud Kubernetes Service (VKS) là dịch vụ quản lý cụm Kubernetes dựa trên mã nguồn mở do Google phát triển. Vận hành trên mô...
hikubernetesservicecloud
https://www.brighttalk.com/webcast/17999/606526
Insights from up-leveling a compute cloud for higher performance—and higher margins With today’s AI boom, more enterprises are turning to cloud-based s...
ai cloudcrusoebuiltservicescale
https://www.f5.com/products/distributed-cloud-services/l3-and-l7-ddos-attack-mitigation
Protect your applications and APIs against L3-L7 attacks with F5 DDoS Mitigation service. Easily scrub traffic using BGP-based redirection for robust security.
distributed cloudddos mitigationservice
https://www.alibabacloud.com/en/product/short-message-service?_p_lc=1
SMS provides a feature of sending multiple messages at a time and various API operations. You can use SMS to send OTP messages, notification messages, and...
alibaba cloudshortmessageserviceglobal
https://senzafili.com/service-monetization-in-cloud-native-digitalized-networks/
May 16, 2025 - A conversation with Udai Kanukolau at Rakuten Symphony on how network transformation enables new monetization platforms
cloud nativeservicemonetizationnetworks
https://www.acecloudhosting.com/blog/choosing-cloud-service-provider/
Aug 21, 2025 - While choosing a cloud service provider, look out for factors such as pricing, security, and BCDR. In this blog, Know how to choose a cloud service provider.
cloud service providerfactorsconsiderchoosing
https://www.chef.io/products/chef-saas
Manage all your DevOps applications in the cloud with Chef SaaS. Learn how to transform into a secure, compliant, coded enterprise with Chef SaaS.
devops cloudsoftwareservicesaaschef
https://www.alibabacloud.com/blog/introducing-the-sixth-generation-of-alibaba-clouds-elastic-compute-service_595716
In this article, you'll learn about some of the new features, technologies and advantages of the newest generation of Alibaba Cloud's Elastic Compute...
alibaba cloudintroducingsixthgenerationelastic
https://www.fortinet.com/products/public-cloud-security/cloud-native-firewall
FortiGate CNF, a cloud-native managed firewall service, simplifies network protection, optimizes costs, and accelerates cloud migration or expansion
cloud nativefortigatecnffirewallservice
https://www.huffingtonpost.fr/tech-futurs/article/apres-amazon-le-service-cloud-de-microsoft-touche-par-une-panne-mondiale_256567.html
Microsoft Azure indique que les perturbations affectent, entre autres, des jeux en ligne ou des services de compagnies aériennes et ferroviaires.
le serviceamazonclouddemicrosoft
https://www.cio.de/article/4079290/berliner-senatsverwaltung-verlagert-it-service-management-in-die-cloud.html
Nov 5, 2025 - Die Berliner Senatsverwaltung für Arbeit, Soziales, Gleichstellung, Integration, Vielfalt und Antidiskriminierung setzt auf ITSM mit Open Source und Cloud.
service managementberlinerdiecloudcio
https://www.acronis.com/en/products/cloud/cyber-protect/backup/
Enjoy safe, secure, and scalable Cloud Backup Solution. Simply buy a subscription, select the cloud backup storage size you need. Get your free trial now!
cloud backupfastsecuremspsolution
https://accuknox.com/blog/mssp-ready-cnapp
Nov 18, 2025 - Discover why AccuKnox is the most MSSP-ready CNAPP, offering multi-tenancy, AI-driven security, scalable compliance, and seamless integrations for MSSPs to...
managed service providerscloud securitymsspreadycnapp
https://www.itsintegra.com/actualites/paroles-dexperts/nutanix-calm-automatisation-du-deploiement-applicatif-multi-cloud/
Jul 30, 2021 - Notre expert, Thierry Del Monde, vous présente Nutanix Calm, la solution d'automatisation du déploiement applicatif de notre partenaire Nutanix.
multi cloudnutanixcalmautomatisationservice
https://www.cybersecuritydive.com/news/ivanti-critical-cves-exploits/727632/
Hackers are exploiting the vulnerability in tandem with a previously disclosed CVE, to bypass authentication measures and take control of an affected system.
cloud serviceattackersexploitsecondivanti
https://www.netalia.it/2025/02/21/public-cloud-system-integrator-msp-e-oltre-il-modello-x-as-a-service-conquista-lit/
Feb 28, 2025 - Netalia sul ruolo degli MSP, anello fondamentale nella catena che unisce aziende, system integrator e cloud provider. La chiave è la collaborazione.
public cloudsystemintegratormspil
https://news.lenovo.com/mass-open-cloud-alliance-leverages-lenovo-truscale-gpu-as-a-service-for-groundbreaking-research/
Oct 21, 2024 - The MOC Alliance optimizes its AI workloads while working towards its sustainability goals with Lenovo TruScale GPUaaS.
open cloudmassalliancelenovogpu
https://www.lemagit.fr/actualites/366580492/Google-Cloud-met-la-GenAI-au-service-des-bases-de-donnees-et-vice-versa
Apr 11, 2024 - Lors de Google Cloud Next’24, GCP a mis en avant un ensemble de fonctionnalités concernant son portfolio de bases de données. Sans...
google cloudmetlagenaiau
https://www.dotsource.de/salesforce-service-cloud/
Mit dem Salesforce CRM automatisieren Sie Workflows, integrieren KI-gestützte Chatbots & leisten Support auf allen Kanälen. Jetzt Termin vereinbaren
salesforce service cloudkundenservice
https://jelvix.com/blog/cloud-service-models
May 7, 2025 - Cloud computing remains one of the most growing markets and trends over the last five years. Find out how to choose cloud service providers.
cloud servicemodelsexplainedsaasiaas
https://www.zenlayer.com/blog/turbocharge-your-gaming-service-with-zenlayer-hyperconnected-cloud/
Jul 3, 2024 - The rapid growth of the gaming industry creates unique infrastructure challenges for game developers and publishers. See how Zenlayer's advance edge...
turbochargegamingservicecloudzenlayer
https://cloud.ionos.de/network/network-loadbalancer
Höchste Verfügbarkeit dank intelligenter Lastverteilung » Integrierter Health Check ✓ Multi-IP-fähig ✓ Frei konfigurierbare Regeln ✓ Sticky Sessions...
load balancerionos cloudmanagednetworkein
https://www.salesforce.com/service/contact-center/?bc=OTH
Oct 9, 2025 - Learn how contact and call center software can deliver proactive, personalized service across all channels including phone, chatbots, and more — at scale.
call center softwareservice cloudbestsalesforce
https://www.cybersecuritydive.com/news/sonicwall-state-linked-actor-attacks-cloud-backup/804867/
CEO announces security and governance reforms inside the company, including the adoption of secure-by-design practices.
cloud backupsonicwallsaysstatelinked
https://www.networkworld.com/article/4050008/sap-data-sovereignty-service-lets-customers-run-cloud-workloads-inside-their-data-centers.html
Sep 3, 2025 - SAP Sovereign Cloud On-Site “delivers the highest levels of data, operational, technical, and legal sovereignty.”
data sovereigntycloud workloadssapservicelets
https://cloud.laravel.com/legal/terms
Deploy and scale Laravel apps without managing servers. Laravel Cloud is fast, secure Laravel hosting with autoscaling. Start free on the Starter plan.
laravel cloudtermsservice
https://netnordicdenmark.dk/hvad-vi-gor/cloud/private-cloud/platform-as-a-service/
May 20, 2025 - Platform as a Service fra NetNordic er din cloud-platform til udvikling, drift og styring af applikationer. Kontakt os i dag.
service cloudplatformtil
https://www.callboxinc.com/industries-we-serve/cloud-computing-lead-generation/
Nov 17, 2025 - Scale your cloud computing pipeline with lead generation. Callbox provides high-quality cloud leads that improve ROI and fuel sustained revenue growth.
cloud service providerslead generation
https://domain-recht.de/internet-politik/sonstiges-internet-politik/cloud-service-ionos-und-bsi-erweitern-ihre-zusammenarbeit-um-die-cyber-resilienz-in-deutschland-zu-staerken-70249.html
Das Bundesamt für Sicherheit in der Informationstechnik (BSI) und der Internetdienstanbieter IONOS SE bauen ihre Zusammenarbeit aus: beide Partner haben eine...
cloud serviceionosundbsierweitern
https://www.photonengine.com/chat
Global cross platform chat as a service (SaaS, Cloud) with channel subscriptions for and publishing in channels, text and binary messages, history and more....
cross platformworldwidechatservicesaas
https://8solutions.de/
Jul 23, 2024 - Professionelle Hostinglösungen, Cloud Produkte, Webdesign und mehr. Für Shopbetreiber, Firmen und Agenturen. Leistungsstarke Server und Kostenloser 24/7...
cloud hostingmanaged servicesinternetprovider
https://www.computerworld.com/article/4118639/aws-european-cloud-service-launch-raises-questions-over-sovereignty.html
Jan 19, 2026 - AWS’s new sovereign cloud for Europe boosts compliance controls, but analysts say its US ownership raises unresolved questions about legal authority and...
cloud serviceawseuropeanlaunchraises
https://granicus.com/success-stories/modernizing-service-delivery-how-service-cloud-powers-resident-first-digital-transformation/
Discover how Service Cloud helps governments modernize services, cut costs, and deliver secure, accessible digital experiences.
service deliverycloudpowersresidentfirst
https://www.ams.com.cy/portfolio/sap-service-cloud/
Dec 30, 2020 - SAP® Service Cloud https://www.youtube.com/watch?v=nPVfX_RBlyY Create a unified service experience with SAP Service Cloud Bridge the gap between front-office...
service cloudams
https://www.hetzner.com/legal/cloud-server/
Find answers to your legal questions about the cloud and vServer service agreement at Hetzner Online GmbH..
service agreementcloudvserver
https://kahionlinemedia.com/how-is-the-salesforce-sales-cloud-is-different-from-service-cloud/
Feb 8, 2025 - When you sign up for Salesforce, you have two module options: Sales Cloud and Service Cloud. Moreover, there is a lot of overlap between Sales Cloud and Serv
salesforce sales clouddifferentservice
https://www.bestbackups.com/cubby-cloud-storage-service-shut-logmein/
LogMeIn has made the decision to shut down its Cloud storage service, Cubby. Users have until November 16th to move their data to a new Cloud.
cloud storagecubbyserviceshutlogmein
https://www.fortinet.com/solutions/cloud-service-providers
Fortinet partners with cloud service providers such as Microsoft, AWS, and Google to enhance cloud security.
cloud service providerscspsfortinet
https://www.civo.com/vmware-service-providers
Navigate the Broadcom takeover of VMware with CivoStack Enterprise. Offering a more affordable solution for service providers.
service providersvmscloudcivocom
https://www.huaweicloud.com/intl/en-us/product/mrs.html
MRS offers enterprise-level scalable big data clusters and open-source components such as Hudi, Doris, Spark, HBase, Flink, Clickhouse and Hadoop for versatile...
big datahuawei cloudservicemrscomponents
https://openmetal.io/use-cases/MSP/
Jul 10, 2025 - Helping managed IT service providers reclaim profits and reinvest in their business success with private cloud and IaaS options.
cloud solutionsservice providersmanagediaas
https://www.salesforce.com/form/service-cloud/guided-tour/?d=pb&bc=OTH
Learn how you can deflect 30% more cases in this guided tour of Service Cloud.
service cloudguided toursalesforcecom
https://1bitup.com/blog/10-passive-income-ideas-2025
Looking for real passive income ideas in 2025? Here are 10 proven strategies that help you earn consistently — from digital investments to automated...
passive income ideasgrowwealth
https://www.granicus.com.au/blog/a-new-era-of-connection-service-cloud-debuts-in-australia-and-new-zealand/
Aug 12, 2025 - Granicus Service Cloud launches in Australia & New Zealand, helping councils deliver seamless, resident-first digital services and engagement.
new eraservice cloudconnectiondebutsaustralia
https://oktawave.com/pl/rozwiazania/vmware
1 kwietnia 2024 r. nastąpiła radykalna zmiana modelu licencjonowania technologii VMware by Broadcom. W czasach zmian, zespół Oktawave w roli VCSP Premier...
cloud service providersofertadlavmware
https://www.acecloudhosting.com/vdi/end-user-computing/
Nov 14, 2025 - Discover reliable End User Computing (EUC) solutions and services from Ace Cloud Hosting. Optimize user experiences and maximize productivity for your business.
end userservice acecloud hostingcomputingeuc
https://www.6dg.co.uk/
Dec 1, 2025 - As the best secure cloud services provider in the UK, we set organisations free to achieve and exceed their boldest aspirations, whatever those may be.
managed service providersixdegreescloud
https://vercara.digicert.com/resources/ultradns
Dec 23, 2024 - In a connected world, as internet users expect seamless and secure online experiences, DNS has become more difficult and complex to manage than ever before.
dns serviceultradnsauthoritativecloudbased
https://openmetal.io/resources/case-studies/customer-success-story-cloud-provider/
Oct 23, 2025 - This company launched a public cloud hosting service on OpenMetal's private cloud IaaS platform while improving both operational and cost efficiencies.
customer success storypublic cloudhosting serviceiaas