Robuta

https://archive.org/details/devicesdesireshi00tone Devices and desires : a history of contraceptives in America : Tone, Andrea, 1964- : Free Download,... Includes bibliographical references and index devices and desires https://womenhelp.org/en/ WHW: abortion and contraceptives — Women Help Women Self-managed abortion. Globally connected, radically ours. whwabortioncontraceptiveswomenhelp https://www.kff.org/womens-health-policy/dimensions-of-new-contraceptives-norplant-and-poor/ Dimensions of New Contraceptives: Norplant and Poor Women | KFF Aug 9, 2025 - Leading reproductive health and family planning experts consider the social policy and public health implications of Norplant, a long-acting method of birth... dimensionsnewcontraceptivespoorwomen https://tobias-lib.ub.uni-tuebingen.de/xmlui/handle/10900/68016?show=full Are hormonal components of oral contraceptives associated with impaired female sexual function? A... https://hspop.uw.edu/publication/use-of-contraceptives-and-fertility-in-panama/ [Use of contraceptives and fertility in Panama]. - Health Systems and Population Health Warren CW, Oberle MW, Medica W, Morris L. [Use of contraceptives and fertility in Panama]. Perspect Int Planif Fam. 1987;(Spec No):6-11. Spanish. in panamahealth systemsusecontraceptivesfertility https://collections.nlm.nih.gov/?f%5Bdrep2.subjectAggregate%5D%5B%5D=Contraceptives%2C+Postcoital Subjects: Contraceptives, Postcoital - Digital Collections - National Library of Medicine Search... national library of medicinedigital collectionssubjectscontraceptivessearch https://www.sciencenews.org/archive/contraceptives-increase-cancers-rats Contraceptives Increase Cancers in Rats | Science News contraceptivesincreasecancersratsscience https://www.walgreens.com/q/emergency+contraceptives Emergency Contraceptives | Walgreens emergency contraceptiveswalgreens https://www.kff.org/affordable-care-act/insurance-coverage-of-otc-oral-contraceptives-lessons-from-the-field/ Insurance Coverage of OTC Oral Contraceptives: Lessons from the Field | KFF Aug 9, 2025 - This report is based on 35 structured interviews conducted from January to August 2023, with nearly 80 experts and key players such as pharmacists, health... lessons from the fieldinsurance coverageoral contraceptivesotc https://www.straitstimes.com/world/united-states/many-modern-contraceptives-still-linked-to-breast-cancer-study Many modern contraceptives still linked to breast cancer: Study | The Straits Times Dec 7, 2017 - NEW YORK (NYTIMES) - Women who rely on birth control pills or contraceptive devices that release hormones face a small but significant increase in the risk for... https://petrieflom.law.harvard.edu/tag/contraceptives/ Contraceptives - Petrie-Flom Center contraceptivespetrieflomcenter https://www.nber.org/papers/w7527 The Power of the Pill: Oral Contraceptives and Women's Career and Marriage Decisions | NBER Founded in 1920, the NBER is a private, non-profit, non-partisan organization dedicated to conducting economic research and to disseminating research findings... the power of https://pubmed.ncbi.nlm.nih.gov/32211577/ Thrombin generation in a woman with heterozygous factor V Leiden and combined oral contraceptives:... Combined oral contraceptives and factor V Leiden mutation are multiplicative risk factors for venous thromboembolism. However, it remains unknown whether this... https://healthpolicy.fsi.stanford.edu/news/rosenkranz-prize-winner-investigates-impact-price-controls-contraceptives Rosenkranz Prize Winner Investigates Impact of Price Controls on Contraceptives | FSI prize winnerprice controlsrosenkranzinvestigatesimpact https://directorblue.blogspot.com/2012/03/photo-in-finally-found-out-why-sandra.html Doug Ross @ Journal: Photos: I Finally Discovered Why Sandra Fluke Wanted Free Contraceptives Damn things are collectors' items now: You think I forgot about this? I'm like a frickin' elephant! I never forget ! https://www.digitaljournal.com/pr/news/contraceptives-market-is-expected-to-expand-steady-2023-2030-sun-pharmaceutical-industries-ltd-perrigo-company-plc-uniprix-gavis-pharmaceuticals Contraceptives Market is Expected to Expand Steady 2023-2030 | Sun Pharmaceutical Industries Ltd.,... https://experts.umn.edu/en/publications/efficacy-of-medication-abortion-with-concurrent-initiation-of-pro/ Efficacy of medication abortion with concurrent initiation of progestin contraceptives: A... medication abortionefficacyconcurrentinitiationcontraceptives https://pubmed.ncbi.nlm.nih.gov/12686037/?dopt=Abstract Cervical cancer and use of hormonal contraceptives: a systematic review Although long duration use of hormonal contraceptives is associated with an increased risk of cervical cancer, the public health implications of these findings... cervical cancerhormonal contraceptivesusesystematicreview https://www.news-medical.net/news/2005/04/06/9034.aspx Hormonal contraceptives increase risk of HSV-2 transmission Jun 19, 2019 - Women who are infected with herpes simplex virus type 2 (HSV-2) may have an increased risk of transmitting the virus to others if they use hormonal... hormonal contraceptivesincreaseriskhsvtransmission https://adisinsight.springer.com/drugsafety/803057260?error=cookies_not_supported&code=d27ef52d-956c-4df8-a62b-103ad9687197 TGA reviews safety of drospirenone-containing oral contraceptives - AdisInsight following the publication of two studies showing an increased risk of venous thromboembolism (VTE) among women taking drospirenone-containing oral oral contraceptivestgareviewssafetydrospirenone https://bluecollarprepping.blogspot.com/2014/06/contraceptives-dangers-and-types.html Blue Collar Prepping: Contraceptives: Dangers and Types Emergency preparedness on a budget, written by real people who practice what they preach and aren't selling anything. blue collar preppingcontraceptivesdangerstypes https://www.cato.org/blog/its-not-about-contraceptives-not-really It's Not About Contraceptives, Not Really | Cato at Liberty Blog cato at libertycontraceptivesreallyblog https://www.gynohealth.com/ Dr. Robert Muller, MD - Gynecologist - Office Gynecology, Physical Exams, Contraceptives,... Camellia Women's Center - Office Gynecology, Well Woman Physical Exams, Contraceptive Management, Menopausal and Hormonal Therapy Management, Adolescent... dr robertphysical examsmullermdgynecologist https://mjgh.library.mcgill.ca/article/view/1250/1324 View of Keeping Contraceptives on the Shelf: on theviewkeepingcontraceptivesshelf https://pmc.ncbi.nlm.nih.gov/articles/PMC10434896/ Assessment of liver function tests of women taking hormonal contraceptives at University of Gondar... Hormonal contraceptives are artificial preparations that contain artificial progestins and Ethinylestradiol; these preparations are utilized by women of... liver function tests https://pubmed.ncbi.nlm.nih.gov/31970131/ Influence of combined oral contraceptives on polycystic ovarian morphology-related parameters in... COC treatment significantly affects ultrasound-assessed PCOM and serum AMH levels of patients with PCOS. oral contraceptives https://www.aafp.org/afp/2012/1101/ot19 One-Year Supply of Oral Contraceptives Associated with Less Pregnancy | AFP one yearoral contraceptivesassociated withsupply https://www.news-medical.net/news/20260109/Self-administered-injectable-contraceptives-face-provider-hesitancy-despite-availability.aspx Self-administered injectable contraceptives face provider hesitancy despite availability Jan 9, 2026 - Self-administered injectable contraceptives have been available in the United States for more than two decades, yet a new study has found only about a quarter... selfinjectablecontraceptivesfaceprovider https://petrieflom.law.harvard.edu/2013/02/11/more-on-contraceptives-coverage/ More on Contraceptives Coverage - Petrie-Flom Center Jan 15, 2026 - By Holly Fernandez Lynch For an excellent perspective on the legal challenges to the contraceptives coverage mandate being brought by for-profit, secular... more oncontraceptivescoveragepetrieflom https://www.post-gazette.com/opinion/letters/2014/07/03/political-distortion/stories/201407030198 Hobby Lobby's position on contraceptives is being distorted | Pittsburgh Post-Gazette The company has been providing coverage for 16 of the 20 contraceptives mandated by the Affordable Care Act. hobby lobby https://pmc.ncbi.nlm.nih.gov/articles/PMC3474155/ Advantages of the association of resveratrol with oral contraceptives for management of... The effect of resveratrol on the management of endometriosis-related pain was investigated in 12 patients who failed to obtain pain relief during use of an... of theoral contraceptivesadvantagesassociationresveratrol https://africa.businessinsider.com/local/lifestyle/dollar10-million-in-contraceptives-meant-for-africa-destroyed-on-orders-from-trump/8nmyqtf $10 million in contraceptives meant for Africa destroyed on orders from Trump officials | Business... The United States Agency for International Development (U https://pubmed.ncbi.nlm.nih.gov/574224/ Chorea induced by oral contraceptives A rare complication of oral contraceptive therapy is the induction of chorea. We here describe five cases of chorea in patients receiving low- or high-dose... choreainducedoralcontraceptives https://healtheducationresources.unesco.org/es/library/documents/mauritians-support-sexuality-education-school-and-access-contraceptives Mauritians support sexuality education in school and access to contraceptives regardless of age |... https://profiles.wustl.edu/en/publications/association-between-oregons-12-month-contraceptive-supply-policy-/ Association between Oregon's 12-Month Contraceptive Supply Policy and Quantity of Contraceptives... https://store.astm.org/d3899-93e02.html D3899 Standard Specification for Rubber Contraceptives-Vaginal Diaphragms (Withdrawn 2002) standard specificationfor rubbercontraceptivesvaginaldiaphragms https://medlineplus.gov/druginfo/meds/a625051.html Ethinyl Estradiol and Norgestrel (Oral Contraceptives): MedlinePlus Drug Information Ethinyl Estradiol and Norgestrel (Oral Contraceptives): learn about side effects, dosage, special precautions, and more on MedlinePlus ethinyl estradioloral contraceptivesnorgestrelmedlineplusdrug https://medlineplus.gov/druginfo/meds/a604032.html Estrogen and Progestin (Vaginal Ring Contraceptives): MedlinePlus Drug Information Estrogen and Progestin (Vaginal Ring Contraceptives): learn about side effects, dosage, special precautions, and more on MedlinePlus vaginal ringestrogencontraceptivesmedlineplusdrug https://www.livescience.com/20262-safe-sex-fun-condoms.html How Safe Sex Can Be Fun | Condoms & Contraceptives | Live Science May 14, 2012 - Certain sexual acts, including varied stimulation, increase sexual pleasure during safe sex, research finds. safe sexcan befuncondomscontraceptives https://pubmed.ncbi.nlm.nih.gov/22018117/ Ophthalmic migraines and combined hormonal contraceptives Ophthalmic migraines and combined hormonal contraceptives ophthalmicmigrainescombinedhormonalcontraceptives https://www.unfpa.org/resources/sexual-and-reproductive-health-and-rights-modern-contraceptives-and-other-medical-supply Sexual and Reproductive Health and Rights: Modern Contraceptives and Other Medical Supply Needs,... Core MessageProvision of modern short- and long-acting contraceptives, information, counselling and services (including emergency reproductive healthother medicalsexualrights https://research.ucalgary.ca/participate/contraceptives-effect-exercise-induced-hypoalgesia-reb22-0936 Contraceptives effect on exercise induced hypoalgesia | Research at UCalgary | University of Calgary https://pmc.ncbi.nlm.nih.gov/articles/PMC6468133/ Oral Contraceptives and Cigarette Smoking: A Review of the Literature and Future Directions - PMC Evidence continues to mount indicating that endogenous sex hormones (eg, progesterone and estradiol) play a significant role in smoking-related outcomes.... https://news.rice.edu/news/2025/millions-women-rely-contraceptives-new-rice-study-shows-they-may-do-more-just-prevent Millions of women rely on contraceptives, but new Rice study shows they may do more than just... https://publikationen.uni-tuebingen.de/xmlui/handle/10900/60546?show=full Contraceptive counselling and self-prescription of contraceptives of German gynaecologists: Results... contraceptivecounsellingselfprescriptiongerman https://www.ibtimes.co.uk/uk-schools-offer-free-condoms-contraceptives-check-teen-pregnancies-1442011 UK Schools to Offer Free Condoms, Contraceptives to Check Teen Pregnancies | IBTimes UK Mar 27, 2014 - Teens should be given morning-after pills, and condoms should always be provided along with other contraceptives. uk schoolsto offerfree condoms https://boris-portal.unibe.ch/entities/publication/e32aeff4-5af3-4e96-a7ca-1dc7495c2d28 Neonicotinoid insecticides can serve as inadvertent insect contraceptives There is clear evidence for sublethal effects of neonicotinoid insecticides on non-target ecosystem service-providing insects. However, their possible impact... insecticidesservecontraceptives https://researchdiscovery.drexel.edu/esploro/outputs/doctoral/Increasing-the-use-of-long-acting/991014632652504721 Increasing the use of long acting reversible contraceptives in primary care - Drexel University https://pubmed.ncbi.nlm.nih.gov/40932399/ Determining the Impact of Combination Oral Contraceptives on Von Willebrand Factor and Factor VIII... The meta-analysis revealed no difference in VWD or FVIII levels between participants with and without COCs. The lack of observed differences suggests that COCs... https://pubmed.ncbi.nlm.nih.gov/34201123/ Safety and Benefits of Contraceptives Implants: A Systematic Review Progestin-only contraceptive implants provide long-acting, highly effective reversible contraception. We searched the medical publications in PubMed, CENTRAL,... benefits ofsafetycontraceptivesimplantssystematic https://www.scirp.org/journal/paperinformation?paperid=39638 Suppressed response to hormonal contraceptives in women of Khairpur, Sindh, Pakistan Discover the effectiveness of hormonal contraceptives in Pakistan. This groundbreaking study examines the levels of fertility hormones in women using hormonal... hormonal contraceptiveswomen ofsuppressedresponse https://www.aafp.org/pubs/afp/issues/2008/0901/p634.html Effect of Antiepileptic Drugs on Oral Contraceptives | AAFP We found no studies that measure, or even estimate, any increase in pregnancy rates in women taking antiepileptic drugs. Antiepileptic drugs known to induce... oral contraceptiveseffectantiepilepticdrugsaafp https://www.fda.gov/regulatory-information/search-fda-guidance-documents/labeling-combined-hormonal-contraceptives-guidance-industry Labeling for Combined Hormonal Contraceptives Guidance for Industry | FDA hormonal contraceptiveslabelingcombinedguidanceindustry https://adisinsight.springer.com/drugsafety/800033539?error=cookies_not_supported&code=578acad7-3088-40ba-b319-f441a67c0116 Oral contraceptives - AdisInsight oral contraceptivesadisinsight https://pmc.ncbi.nlm.nih.gov/articles/PMC4135453/ The effects of hormonal contraceptives on glycemic regulation - PMC A number of side effects have been linked to the use of hormonal contraceptives, among others, alterations in glucose levels. Hence, the objective of this... hormonal contraceptiveseffectsglycemicregulationpmc https://pubmed.ncbi.nlm.nih.gov/21391524/ Preventing gaps when switching contraceptives Unintended pregnancy can occur when women stop one birth control method before starting another. To prevent gaps in contraception, physicians should ask women... preventinggapsswitchingcontraceptives https://revistas.usp.br/rsp/en/article/view/156156 Social inequalities in the use of contraceptives in adult women from Southern Brazil | Revista de... https://pubmed.ncbi.nlm.nih.gov/32404240/ Oral Contraceptives in Dermatology Oral contraceptives combine estrogen and progesterone to suppress ovulation. Synthetic forms are usually used. In dermatology, oral contraceptives are... oral contraceptivesdermatology https://research-portal.uu.nl/en/publications/how-oral-contraceptives-impact-social-emotional-behavior-and-brai/ How Oral Contraceptives Impact Social-Emotional Behavior and Brain Function - Utrecht University oral contraceptivesimpact social https://pubmed.ncbi.nlm.nih.gov/12686037/ Cervical cancer and use of hormonal contraceptives: a systematic review Although long duration use of hormonal contraceptives is associated with an increased risk of cervical cancer, the public health implications of these findings... cervical cancerhormonal contraceptivesusesystematicreview https://culturecampaign.blogspot.com/2008/05/planned-parenthood-begs-feds-to-fund.html CULTURE NEWS: Planned Parenthood Begs Feds to Fund Contraceptives for Starving College Kids Students forced to choose between food or expensive contraceptives, so government should fix this so-called 'devastating problem' Tell your ... https://pubmed.ncbi.nlm.nih.gov/27465589/?dopt=Abstract Effectiveness of demand generation interventions on use of modern contraceptives in low- and... Demand generation interventions contribute to increases in modern contraceptive methods use. However, more studies with robust designs are needed to identify... demand generation https://open.library.emory.edu/concern/publications/dd964a15-294f-40db-ac7f-9d47f9b7195f Impact of Hormonal Contraceptives on Cervical T-helper 17 Phenotype and Function in Adolescents:... Impact of Hormonal Contraceptives on Cervical T-helper 17 Phenotype and Function in Adolescents: Results from a Randomized, Crossover Study Comparing... https://scholars.duke.edu/publication/1597962 Scholars@Duke publication: Pregnancy rates in HIV-positive women using contraceptives and... pregnancy rates https://adisinsight.springer.com/trials/700052220?error=cookies_not_supported&code=754bbc8b-e762-4b71-96c4-289a773068db The Effect of Prucalopride on the Plasma Levels of Oral Contraceptives (Ethinylestradiol and... This trial investigated the effects of co-administration of prucalopride and oral contraceptives (ethinylestradiol/norethisterone) on the effectoral contraceptivesprucalopride https://pmc.ncbi.nlm.nih.gov/articles/PMC5727291/ Oral Contraceptives and Renal Water Handling: A diurnal study in young women - PMC To test the hypothesis that use of oral contraceptives (OC) changes diurnal variation in fluid balance mechanisms including blood pressure, secretion of... https://lesfemmes-thetruth.blogspot.com/2014/02/contraceptives-real-war-on-women.html LES FEMMES - THE TRUTH: Contraceptives: The Real War on Women! US athlete says she missed shot at Olympics because of blood clots from contraceptive device Chemical contraceptives are poison. If you a... les femmesthe truthcontraceptivesrealwar https://medlineplus.gov/druginfo/meds/a625056.html Ethinyl Estradiol and Ethynodiol Diacetate (Oral Contraceptives): MedlinePlus Drug Information Ethinyl Estradiol and Ethynodiol Diacetate (Oral Contraceptives): learn about side effects, dosage, special precautions, and more on MedlinePlus ethinyl estradioloral contraceptivesmedlineplusdruginformation https://pubmed.ncbi.nlm.nih.gov/8757152/ Haemorrhagic stroke, overall stroke risk, and combined oral contraceptives: results of an... The risk of haemorrhagic stroke attributable to OC use is not increased in younger women and is only slightly increased in older women. The estimated excess... oral contraceptivesstrokeoverallrisk https://hexi.ox.ac.uk/acne/acne-treatments-hormonal-contraceptives Acne (young people) - Acne treatments: hormonal contraceptives young peopleacnetreatmentshormonalcontraceptives https://pure.psu.edu/en/publications/effect-of-pretreatment-with-oral-contraceptives-and-progestins-on/ Effect of pretreatment with oral contraceptives and progestins on IVF outcomes in women with... https://doctor.ndtv.com/faq/can-i-take-oral-contraceptives-safely-with-hypertension-8980 Can I take oral contraceptives safely with hypertension? I have been married for 2 months now and opted for oral contraceptives for birth control. But I am a patient of hypertension and also have a minor leakage in... can ioral contraceptivestakesafelyhypertension https://pubmed.ncbi.nlm.nih.gov/28049361/ Oral Contraceptives and HRT Risk of Thrombosis Estrogen-containing medication, prescribed either for contraception in women of reproductive age or for prevention of cardiovascular events and osteoporosis as... oral contraceptiveshrtriskthrombosis https://groups.diigo.com/group/Catholic/content/tag/contraceptives?dm=simple&page_num=0 Group items tagged contraceptives - Catholic | Diigo Groups Welcome! This is a group for those who are Catholic and those who have an interest in learning more about our Holy Catholic Faith. This group is faithful to... groupitemstaggedcontraceptivescatholic https://www.cochrane.org/evidence/CD006133_hormone-contraceptives-and-how-body-uses-carbohydrates-women-without-diabetes Hormone contraceptives and how the body uses carbohydrates in women without diabetes | Cochrane https://yorkspace.library.yorku.ca/items/6e032262-acc3-408c-9417-aef5b0d8e46c/full The Influence of Oral Contraceptives on the Autonomic Nervous System This thesis aims to determine the effects of oral contraceptives (OC) on resting autonomic function, autonomic reflex activation, and cerebral blood flow... the influenceoral contraceptivesautonomicnervoussystem https://statesofexception.substack.com/p/in-search-of-fish-condoms In Search of Fish Contraceptives - by Glenn If you care about fish, stop them from having sex. in search offishcontraceptivesglenn https://yorkspace.library.yorku.ca/items/1afb8d8a-452f-4ce3-b9b7-92c993e3f3af Influence of sex, menstrual cycle, and oral contraceptives on the cerebrovascular response to paced... Purpose Deep breathing assesses autonomic function; however, many researchers/clinicians do not account for hyperventilation, brain blood flow or blood... https://adisinsight.springer.com/drugsafety/803638019?error=cookies_not_supported&code=7d09a1bb-7dc8-4683-949a-ecf2edf681b6 Increase in thromboembolic ADRs from oral contraceptives during COVID-19 pandemic in Spain -... A disproportionate increase in thromboembolic events (TEs) in women receiving oral systemic hormonal contraceptives (SHC) in Spain during the COVID-19 pandemic oral contraceptives https://pha.studentorg.berkeley.edu/2018/05/18/accessing-emergency-contraceptives-vending-machines/ Accessing Emergency Contraceptives: Vending Machines | The Public Health Advocate Vending machines have traditionally offered candies and snacks to passersby. Now, college campuses are embracing vending machines that offer access to... emergency contraceptivesvending machinesthe publicaccessinghealth https://pmc.ncbi.nlm.nih.gov/articles/PMC5662520/ Hormonal contraceptives and risk of ischemic stroke in women with migraine: a consensus statement... Several data indicate that migraine, especially migraine with aura, is associated with an increased risk of ischemic stroke and other vascular events. Of... https://globalnews.ca/video/10477882/health-minister-demands-conservatives-to-stop-blocking-free-contraceptives-for-women-across-canada/ Health minister demands Conservatives to stop blocking free contraceptives for women across Canada... Watch Health minister demands Conservatives to stop blocking free contraceptives for women across Canada Video Online, on GlobalNews.ca https://embryo.asu.edu/taxonomy/term/144740 Contraceptives, Oral, Combined | Embryo Project Encyclopedia contraceptivesoralcombinedembryoproject https://culturecampaign.blogspot.com/2013/09/obama-says-his-daughters-need-free.html CULTURE NEWS: Obama Says His Daughters Need Free Contraceptives Speaking before adoring fans in Maryland yesterday, President Obama explained the dire need of Americans for ObamaCare, mentioning that his ... culture newsobamasaysdaughtersneed https://pubmed.ncbi.nlm.nih.gov/35068876/ Use of oral contraceptives and risk of pancreatic cancer in women: A recalculated meta-analysis of... In a recent systematic review and meta-analysis of observational studies, the author found potential errors in the selection and extraction processes. The... https://pubmed.ncbi.nlm.nih.gov/17361533/?dopt=Abstract When contraceptives change monthly bleeding When contraceptives change monthly bleeding contraceptiveschangemonthlybleeding https://microdata.worldbank.org/catalog/3380 Cameroon - Increasing the Uptake of Long-acting Reversible Contraceptives Among Adolescent and... https://pubmed.ncbi.nlm.nih.gov/15814774/ Association between the current use of low-dose oral contraceptives and cardiovascular arterial... In conclusion, a rigorous meta-analysis of the literature suggests that current use of low-dose OCs significantly increases the risk of both cardiac and... https://www.ht-ventures.com/ Healthtech Ventures | Digital Healthcare Solutions | Prio One, SoLean, NextGen Contraceptives Healthtech Ventures - HTV: Transforming healthcare by digitizing and democratizing essential services. Discover Prio One women's healthcare, SoLean GLP-1... digital healthcare solutionshealthtechventuresprioone https://pmc.ncbi.nlm.nih.gov/articles/PMC27524/ Risk of venous thromboembolism among users of third generation oral contraceptives compared with... To compare the risk of idiopathic venous thromboembolism among women taking third generation oral contraceptives (with gestodene or desogestrel) with that... venous thromboembolism https://pmc.ncbi.nlm.nih.gov/articles/PMC9661645/ Oral contraceptives and colorectal cancer risk - A meta-analysis and systematic review - PMC There is limited understanding of the potential relationship between the risk of colorectal cancer and oral contraceptive use among women of different ages.... oral contraceptivescolorectal cancer https://pubmed.ncbi.nlm.nih.gov/14558321/?dopt=Abstract Factors influencing young Malians' reluctance to use hormonal contraceptives During a qualitative evaluation of three peer-education programs in urban Mali, young people stated that they were wary of using either the pill or injectable... factorsinfluencingyoungreluctanceuse https://html5-player.libsyn.com/embed/episode/id/21736721/height/90/theme/custom/thumbnail/yes/direction/backward/render-playlist/no/custom-color/87A93A/ Re-Thinking Birth Control: The Effects of Contraceptives on Your Hormones with Dr. Felice Gersh https://www.techtarget.com/patientengagement/news/366584224/Access-to-Contraceptives-Improves-College-Graduation-Rates-12 Access to Contraceptives Improves College Graduation Rates 12% | TechTarget New data finds that improve access to contraceptives via the Title X Family Planning program in Colorado improve college graduate rates and conference of... access tocollege graduationcontraceptivesimprovesrates https://events.ubc.ca/event/ubc-cpd-implants-and-iuds-comparing-and-inserting-long-acting-reversible-contraceptives-larc/ UBC CPD: Implants and IUDs: Comparing and Inserting Long Acting Reversible Contraceptives (LARC) -... We are back in person on Nov 16, 2024 at UBC Robson Square in Vancouver, BC for the Implants and IUDs: Comparing and Inserting Long Acting Reversible... https://www.kff.org/womens-health-policy/insurance-coverage-of-contraceptives/ Insurance Coverage of Contraceptives | KFF Aug 9, 2025 - In this post, we answer some of the key questions about the new contraceptive coverage policy generally, and more specifically, how it will be applied to... insurance coveragecontraceptiveskff https://www.allcontraceptives.com/index.html All Contraceptives | Birth Control Pills | Implants | Injections All Contraceptives supplies High quality Birth Control Pills, Implants, Contraceptive Injections and also Emergency Contraceptive Pills at affordable prices. birth control pillscontraceptivesimplantsinjections https://edrn.cancer.gov/data-and-resources/publications/34862209-associations-of-oral-contraceptives-with-mammographic-breast-density-in-premenopausal-women/ Associations of Oral Contraceptives with Mammographic Breast Density in Premenopausal Women. This is a pbulication by a member of the Early Detection Research Network. oral contraceptivesbreast densityassociations https://pmc.ncbi.nlm.nih.gov/articles/PMC7586815/ Oral contraceptives and the serotonin 4 receptor: a molecular brain imaging study in healthy women... Sex steroid hormones potently shape brain functions, including those critical to maintain mental health such as serotonin signaling. Use of oral contraceptives... https://pubmed.ncbi.nlm.nih.gov/35876180/ Drug-drug interactions between psychotropic medications and oral contraceptives Women taking antiepileptic agents with strong to moderate enzyme-inducing properties (carbamazepine, phenobarbital, phenytoin) or those with moderate to mild... drug interactionspsychotropic medicationsoralcontraceptives