https://www.themoscowtimes.com/2014/03/07/ukraine-president-moves-to-disband-crimean-supreme-council-a32774
Ukraine President Moves to Disband Crimean Supreme Council
May 20, 2026 - Ukraine's interim president has moved to disband the Crimean local legislature after it approved a referendum to ask the region's voters whether they wanted...
ukrainepresidentmovesdisbandcrimean
https://data.fitzmuseum.cam.ac.uk/id/object/155676
The Fitzwilliam Museum - Turkish Crimean Medal: CM.QC.5084-R
A record for a Fitzwilliam Museum object: Turkish Crimean Medal CM.QC.5084-R
the fitzwilliam museumturkishcrimeanmedalcm
https://gutenberg.org/ebooks/subject/16130?sort_order=title
Books about Crimean War, 1853-1856 -- Juvenile fiction - Project Gutenberg
Project Gutenberg offers 78,492 free eBooks for iPhone, iPad, Kobo, Android and Kindle.
books aboutcrimean warjuvenile fictionprojectgutenberg
https://bobthepainter.blogspot.com/2017/03/
20mm Crimean War Wargaming and Other Stuff: March 2017
crimean warand otherwargamingstuffmarch
https://www.themoscowtimes.com/2014/04/24/russia-accused-of-building-new-berlin-wall-on-crimean-border-a34608
Russia Accused of Building New 'Berlin Wall' on Crimean Border
May 19, 2026 - A former Ukrainian foreign minister has accused Russia of building a new "Berlin Wall" by laying land mines between Crimea and the Ukrainian mainland.
building newberlin wallrussiaaccusedcrimean
https://www.aa.com.tr/en/world/ukraine-claims-strike-on-crimean-oil-terminal-used-by-russian-forces/3353762
Ukraine claims strike on Crimean oil terminal used by Russian forces
Oct 7, 2024 - Fire reported at Feodosia port following alleged Ukrainian attack | Anadolu
oil terminalused byukraineclaimsstrike
https://www.rferl.org/a/ukraine-dzhemilev-wife-safinar-interview/26932164.html
'Just Give Us Our Freedom,' Says Wife Of Exiled Crimean Tatar Leader
Mustafa Dzhemilev, the long-time leader of the Crimean Tatars has been banned from the peninsula since Russia annexed the Ukrainian region in March 2014. But...
just giveour freedom
https://www.rferl.org/a/ukraine-russia-ambulance-called-to-crimean-court-for-hunger-striking-defendant/29291979.html
Ambulance Called To Crimean Court For Hunger-Striking Ukrainian Defendant
An ambulance has been called to a court in Russian-controlled Crimea after defendant Volodymyr Balukh, an imprisoned pro-Kyiv activist who has been on hunger...
ambulancecalledcrimeancourthunger
https://stacks.cdc.gov/view/cdc/16198
Lookback Exercise with Imported Crimean-Congo Hemorrhagic Fever, Senegal and France
A patient with suspected malaria was hospitalized successively in 2 hospitals, first in Dakar, Senegal, then in Rennes, France, where tests diagnosed...
hemorrhagic feverlookbackexerciseimportedcrimean
https://bobthepainter.blogspot.com/2019/02/warrior-miniatures-french-line-infantry.html
20mm Crimean War Wargaming and Other Stuff: Warrior Miniatures - French Line Infantry
Another French Line unit joins my Peninsular army:
crimean warand other
https://www.livescience.com/archaeology/human-evolution/crimean-stone-age-crayons-were-used-by-neanderthals-for-symbolic-drawings-study-claims
Crimean Stone Age 'crayons' were used by Neanderthals for symbolic drawings, study claims | Live...
Nov 1, 2025 - Scientists have discovered Stone Age "crayons" in Crimea, hinting that Neanderthals may have used them for symbolic drawings or markings. But not everyone...
https://anglicandownunder.blogspot.com/2014/03/is-this-communions-crimean-moment.html?showComment=1393926187221
Anglican Down Under: Is this the Communion's Crimean moment?
While the world watches as Putin realigns Russian interests in Ukraine, taking over Crimea, threatening the possibility of further realignme...
down underthe communionanglicancrimeanmoment
https://publichealth.berkeley.edu/articles/spotlight/research/how-crimean-congo-hemorrhagic-fever-virus-makes-us-sick
Research reveals new insights into how Crimean-Congo hemorrhagic fever virus makes us sick | UC...
May 14, 2025 - More than 75 years of transformational research and hands-on social impact for a better world.
https://www.rferl.org/a/russian-justice-ministry-calls-for-brave-crimean-lawyer-s-expulsion-from-bar-association/29708692.html
Russian Justice Ministry Calls For 'Brave' Crimean Lawyer's Expulsion From Bar Association
Human Rights Watch says Russian authorities are increasing pressure on Emil Kurbedinov, a prominent Crimean lawyer who has been working on high-profile cases...
https://1815-1918.blogspot.com/2012/03/he-defence-of-sevastopol-crimean-war.html
Warfare in the Age of Steam: The Defence of Sevastopol, Crimean War (1853-1856)....
Reconstruction of defence of "Kamchatka" redoubt by the Russian army in 1854. Participants: Cremean reenactors club, French reenactors club ...
the age of steam
https://bobthepainter.blogspot.com/2020/08/gurkhas-more-colonial-troops.html
20mm Crimean War Wargaming and Other Stuff: Gurkhas - more colonial troops
Apologies to those who left comments on my last post, but my laptop seems to have contracted COVID 19 and failed to work. I have also rever...
crimean warand otherwargaming
https://l10n.gnome.org/languages/crh/freedesktop-org/doc/
freedesktop.org (non-GNOME) - Crimean Tatar
freedesktopnongnomecrimeantatar
https://www.rferl.org/a/crimea-world-war/25375944.html
The Siege Of Sevastopol: Why The Crimean Campaign Means So Much To Moscow
The fierce fighting on the Crimean Peninsula -- and particularly around the strategic port city of Sevastopol -- is one of the most dramatic and impressive...
siege of sevastopol
https://tobias-lib.ub.uni-tuebingen.de/xmlui/handle/10900/90168
Outbreak of Crimean-Congo haemorrhagic fever with atypical clinical presentation in the Karak...
https://en.iz.ru/en/1819446/2025-01-09/first-hearing-case-terrorist-attack-crimean-bridge-will-be-held-january-21
The first hearing in the case of the terrorist attack on the Crimean bridge will be held on January...
Jan 9, 2025 - The first hearing in the criminal case against eight people accused of involvement in the terrorist attack on the Crimean bridge in October 2022 will be held...
https://bobthepainter.blogspot.com/2023/06/
20mm Crimean War Wargaming and Other Stuff: June 2023
crimean warand otherwargamingstuffjune
https://ourstory.randwick.nsw.gov.au/nodes/view/3253
Crimean War Cannons | Randwick City Council
Date Installed: 1920 | Read the full record details for Monuments: Crimean War Cannons
crimean warcannonsrandwickcitycouncil
https://scottyswargaming.blogspot.com/2013/07/crimean-war-project-part-2.html
Scotty's Wargaming: Crimean War project part 2
I have manged to get a second infantry regiment done. This time the 9 stands of the Minsk regiment. As usual the figures are all by Pendrake...
crimean warscottywargamingprojectpart
https://www.rferl.org/a/crimean-tatars-detained-protesting-jailing-karametov/28675536.html
Five Crimean Tatars Detained During Pickets In Simferopol
Five Crimean Tatar activists have been detained while protesting the jailing of Server Karametov, a 76-year-old man who has Parkinson's disease, by the...
crimean tatarsfivedetainedpicketssimferopol
https://en.wikipedia.org/wiki/Crimean_Tatar
Crimean Tatar - Wikipedia
crimean tatarwikipedia
https://openeuropeblog.blogspot.com/2014/03/could-different-type-of-eu-have-avoided.html?showComment=1395053793100
Open Europe: Could a different type of EU have avoided the Crimean crisis?
Over on Conservative Home Open Europe's Christopher Howarth wrote the following article: Firstly, a disclaimer: Russia is 100 per cent r...
https://www.rferl.org/a/pretrial-detention-crimean-tatar-activist-prolonged/28171450.html
Pretrial Detention Of Crimean Tatar Activist Prolonged
A court in Russian-controlled Crimea has prolonged pretrial detention for jailed Crimean Tatar activist Ahtem Ciygoz for another three months.
pretrial detentioncrimean tataractivistprolonged
https://lrc.la.utexas.edu/lex/languages/CrGo
Indo-European Lexicon: Crimean Gothic Reflex Index
indoeuropeanlexiconcrimeangothic
https://www.themoscowtimes.com/archive/shoigu-lavrov-deny-that-crimean-forces-are-russian
Shoigu, Lavrov Deny that Crimean Forces are Russian
Mar 6, 2014 - Defense Minister Sergei Shoigu on Wednesday denied that Russian forces are currently deployed in Ukraine's Crimea region and said that video footage showing...
shoigulavrovdenycrimeanforces
https://bobthepainter.blogspot.com/2020/08/bavarian-napoleonic-foot-artillery.html
20mm Crimean War Wargaming and Other Stuff: Bavarian napoleonic Foot Artillery
I bought these figures off Ebay a couple of months ago from a chap in France. The figures had been neatly painted in a very basic way, so I...
crimean warand otherwargaming
https://www.rferl.org/a/crimean-tatar-detained-over-pre-annexation-clash/26896990.html
Crimean Tatar Man Detained Over Pre-Annexation Clash
A Crimean Tatar activist has been arrested over a clash on the Black Sea peninsula in February 2014, shortly before Russia seized control.
crimean tatarmandetainedpreannexation
https://stacks.cdc.gov/view/cdc/160621
Viral hemorrhagic fevers Crimean-Congo hemorrhagic fever virus: (Week 35) Weekly cases* of...
This data includes weekly cases of notifiable diseases, United States, U.S. Territories, and Non-U.S. Residents, specifically covering Crimean-Congo...
https://english.yale.edu/publications/crimean-war-british-imagination
The Crimean War in the British Imagination | English
the crimean warbritishimaginationenglish
https://bobthepainter.blogspot.com/2018/03/
20mm Crimean War Wargaming and Other Stuff: March 2018
crimean warand otherwargamingstuffmarch
https://bobthepainter.blogspot.com/2023/11/more-airfix-romans.html
20mm Crimean War Wargaming and Other Stuff: More Airfix Romans
I have finished off the last of my Airfix Roman infantry, although I still have a unit of archers to paint. In this instance, I have reposi...
crimean warand otherwargamingstuffairfix
https://bobthepainter.blogspot.com/2016/11/
20mm Crimean War Wargaming and Other Stuff: November 2016
crimean warand otherwargamingstuffnovember
https://www.rferl.org/a/1064025.html
Ukraine: Authorities, Crimean Villagers Worry That Bird Flu Is Spreading
Ukraine's authorities responded swiftly to an outbreak of bird flu on Ukraine's Crimean Peninsula in early December, but now fear their containment efforts may...
bird fluukraineauthoritiescrimeanvillagers
https://bobthepainter.blogspot.com/2023/08/balaclava-revisited-battle-report.html
20mm Crimean War Wargaming and Other Stuff: Balaclava Revisited - Battle Report
I have played variations of the Battle of Balaclava several times in the past, however, the presence of Phil and Will presented an opportun...
crimean warand otherwargaming
https://bobthepainter.blogspot.com/2013/
20mm Crimean War Wargaming and Other Stuff: 2013
crimean warand otherwargamingstuff
https://www.rferl.org/a/crimea-rferl-yesypenko-detention/31344070.html
Crimean Court Extends Detention Of RFE/RL Journalist By Six Months
A court in Russian-occupied Crimea has extended the detention of an RFE/RL freelance correspondent by six months as hundreds were set to rally in Ukraine for...
crimeancourtextendsdetention
https://scottyswargaming.blogspot.com/2013/08/crimean-war-part-iv.html
Scotty's Wargaming: Crimean War part IV
I've been making some more progress on this project, starting on a second infantry division. First up is the Borodino regiment. This comes i...
crimean warscottywargamingpartiv
https://articlezmoj.web.app/degasperis6784py/crimean-war-essay-errol-morris-suq.html
Crimean war essay errol morris fvnxi
crimean warerrol morrisessay
https://www.rferl.org/a/abductions-torture-hybrid-deportation-crimean-tatar-activist-describes-six-years-under-russian-rule/30493504.html
Abductions, Torture, 'Hybrid Deportation': Crimean Tatar Activist Describes Six Years Under Russian...
Crimean Tatar activist Mumine Saliyeva, whose husband faces up to 20 years in prison on terrorism charges he says are fabricated, speaks to RFE/RL about the...
crimean tatar
https://bobthepainter.blogspot.com/2020/04/ros-french-imperial-guard-grenadiers.html
20mm Crimean War Wargaming and Other Stuff: Ros French Imperial Guard Grenadiers
My main effort for the last couple of weeks has been the refurbishment of my Ros Prussian army, however, as I paint with gloss paints there ...
crimean warand other
https://bobthepainter.blogspot.com/2024/05/battle-of-boyne.html
20mm Crimean War Wargaming and Other Stuff: Battle of the Boyne
The final troops arrive, just in time for today's battle. Both sides are now taking up positions on either side of the River Boyne. More c...
crimean warand otherwargaming
https://www.rferl.org/a/crimean-history-book-to-be-yanked-after-nazi-outcry/29776368.html
Crimean History Book To Be Yanked After 'Nazi' Outcry
A new Crimean history textbook will be withdrawn after harsh criticism by human rights activists and Crimean Tatar.
history bookcrimeannazioutcry
https://1815-1918.blogspot.com/2024/03/avanpost-28mm-crimean-war.html
Warfare in the Age of Steam: Avanpost 28mm Crimean War
Here comes a big update to 'Crimean War' range in 28 mm: firing and loading Russian musketeers, in casquets or forage caps three more Russi...
the age of steamwarfareavanpostcrimean
https://stracmark.blogspot.com/2020/01/crimean-war-turks.html
1866 and all that: Crimean War Turks
Ever since I had the idea of collecting for the Crimean War I wanted to do a small supporting force of Turks. The only manufacturer of Crime...
all thatcrimean warturks
https://www.rferl.org/a/exiled-crimean-tatar-leader-prison/31285004.html
Exiled Crimean Tatar Leader Gets Six Years
A Moscow-imposed court in the Russian-annexed Ukrainian region of Crimea on June 1 sentenced the leader of the Crimean Tatars' self-governing body to six years...
crimean tatarexiledleadergetssix
https://newrepublic.com/article/117002/what-happens-after-crimean-referendum
What Happens After the Crimean Referendum | The New Republic
May 11, 2021 - On Sunday, the people of Crimea will have the chance tovote to leave Ukraine and join the Russian Federation.
what happens aftercrimeanreferendumnewrepublic
https://pubmed.ncbi.nlm.nih.gov/164135/
Crimean hemorrhagic fever-Congo (CHF-C) virus antibodies in man, and in domestic and small mammals,...
A Crimean hemorrhagic fever-Congo (CHF-C) virus antibody survey was carried out in Iran with sera from man and several animal species; this survey was done by...
https://l10n.gnome.org/languages/crh/gnome-gimp/ui/
GIMP and Friends - Crimean Tatar
and friendsgimpcrimeantatar
https://abcwargamers.blogspot.com/2018/01/minifigs-s-range-crimean-war-new-years.html
abc wargamers: Minifigs S Range Crimean War New Year's Parade - Russians
ABC Wargamers is a blog about wargaming. The site features buildings and ships built by Jack Alexander as well as wargames.
s rangecrimean warnew yearabcminifigs
https://clint-anythingbutaone.blogspot.com/2019/05/here-are-some-wargames-foundry-28mm.html
ANYTHING BUT A ONE!: 28mm Crimean war figures.
Here are some wargames Foundry 28mm British Infantry of the Crimean war. Firsty I know VERY little about this war or the uniforms and units ...
a onecrimean waranythingfigures
https://bobthepainter.blogspot.com/2019/12/minifigs-scots-greys.html
20mm Crimean War Wargaming and Other Stuff: Minifigs Scots Greys
Taking a break from renovating ancients, I decided to finish off these Napoleonic British cavalry figures. They were started over a year ago...
crimean warand otherwargamingstuffminifigs
https://www.themoscowtimes.com/2022/03/04/north-crimean-canal-fills-with-water-after-russian-forces-destroyed-dam-a76755
North Crimean Canal Fills With Water After Russian Forces Destroyed Dam - The Moscow Times
May 21, 2026 - The North Crimean Canal has begun to fill with water, the Russian state news service RIA reported on Friday.
https://www.rferl.org/a/casualties-reported-in-crimea-explosion-/29548405.html
Russia Says 19 Killed As Student Gunman Rampages Through Crimean College
Russian authorities say 19 students and faculty members at a college in Crimea have been killed, many of them teenagers, in a bomb-and-gun attack they say was...
as studentrussiasayskilled
https://bobthepainter.blogspot.com/2019/08/soviet-forces-muster.html
20mm Crimean War Wargaming and Other Stuff: Soviet Forces Muster
My soviet army is coming together quite well, although I think I need a little more armour and infantry, given the size of the area they are...
crimean warand othersoviet forceswargamingstuff
https://hurmaninvesterarfspj.web.app/74874/92080.html
Russian-Ottoman Relations Online, Part 3: The Crimean War
russianottomanrelationsonlinepart
https://www.themoscowtimes.com/2014/11/04/russias-repression-of-crimean-tatars-repeats-ussrs-mistake-a41030
Russia's Repression of Crimean Tatars Repeats U.S.S.R.'s Mistake
May 14, 2026 - Opinion | The most serious ethno-political conflict in Russia today is not the intense xenophobia found in Moscow, St.
crimean tatarsrussiarepressionrepeatsmistake
https://en.wikipedia.org/wiki/Crimean_Tatars
Crimean Tatars - Wikipedia
crimean tatarswikipedia
https://www.rferl.org/a/Linguists_Urge_Crimean_Tatars_To_Switch_To_Latin_Alphabet/1960330.html
Linguists Urge Crimean Tatars To Switch To Latin Alphabet
Crimean Tatar language experts have approved a move to stop using the Cyrillic alphabet and return to the Latin alphabet.
crimean tatarslinguistsurgeswitchlatin
https://boris-portal.unibe.ch/entities/publication/9f87ca8a-1b34-442e-b3dc-7a72b9a51a18
The (F)actors of Crimean Separatism, 1991-2014. A conflict between Silence and Noise
https://isteve.blogspot.com/2014/03/crimean-problem-practically-solved-part.html?showComment=1393915801838
Steve Sailer: iSteve: Crimean problem practically solved, Part II
Following last week's announcement by Ramzan Kadyrov that his Chechens are ready to bring peace to troubled Eastern Europe, we have word...
steve sailercrimeanproblempracticallysolved
https://www.voanews.com/a/putin-warns-ukraine-against-committing-any-reckless-acts-/4675776.html
Crimean Court Orders Captured Ukrainian Sailors Detained
Russia, which annexed Crimea, accused the sailors of illegally entering Russian waters and ignoring warnings from Russian border guards, charges Ukraine has...
court orderscrimeancapturedukrainiansailors
https://bobthepainter.blogspot.com/2020/07/british-rml-25-screw-gun-with-indian.html
20mm Crimean War Wargaming and Other Stuff: British RML 2.5" Screw Gun with Indian Crew
Continuing to add to my colonial forces, then next item off the production line is this rather nice Screw Gun with Indian crew. The model an...
https://bobthepainter.blogspot.com/2017/11/
20mm Crimean War Wargaming and Other Stuff: November 2017
crimean warand otherwargamingstuffnovember
https://vintagewargaming.blogspot.com/2010/10/minor-minifigs-s-range-mystery-one.html?m=0
Vintage Wargaming: Minor Minifigs S Range Mystery - One Piece Crimean War Cavalry Figures
John has sent me these pictures of some one piece casting cavalry figures he has acquired recently. A small mystery, as the S Range cavalry...
https://l10n.gnome.org/languages/crh/all/ui-part/
All modules - Crimean Tatar
all modulescrimeantatar
https://en.iz.ru/en/2026139/2026-01-17/traffic-police-told-about-possible-introduction-new-restrictions-crimean-bridge
The traffic police told about the possible introduction of new restrictions on the Crimean bridge |...
Jan 17, 2026 - For vehicles weighing more than one and a half tons, travel on the Crimean Bridge may be restricted. This was announced on January 16 by Anatoly Borisenko,...
https://l10n.gnome.org/languages/crh/gnome-42/ui/
GNOME 42 (old stable) - Crimean Tatar
gnomeoldstablecrimeantatar
https://bobthepainter.blogspot.com/2025/11/memoir-44-us-paratroops.html
20mm Crimean War Wargaming and Other Stuff: Memoir '44 - US Paratroops
My final batch of soldiers consists of a load of US paratroopers. The figures are by ESCI, which I think look OK when painted. That's me ...
crimean warand otherwargaming
https://www.rferl.org/a/ukraine-crimea-tatars-dzhemilev/25374059.html?ref=opendemocracy.net
Interview: Crimean Tatar Leader Expects Tensions To Rise
Crimean Tatar leader Mustafa Dzhemilev has been denied entry into Crimea, and the Russian-backed authorities running Crimea say the Crimean Tatars' main...
crimean tatarinterviewleaderexpectstensions
https://researchingfoodhistory.blogspot.com/2018/05/crimean-war-steamers-abundance-bakery.html
Researching Food History : Crimean War steamers Abundance (bakery) and Bruiser (flour mill)
The famed cook Alexis Soyer (1810-1858) wrote Soyer's Culinary Campaign (1857) about his experiences to improve the cooking and baking fo...
food historycrimean war
https://bobthepainter.blogspot.com/2016/10/
20mm Crimean War Wargaming and Other Stuff: October 2016
crimean warand otherwargamingstuffoctober
https://www.rferl.org/a/russia-crimea-tatar-prison/31950194.html
Another Crimean Tatar Handed Lengthy Prison Term In Russia On Extremism Charge
A court in Russia has sentenced Crimean Tatar activist Azamat Eyupov to a lengthy prison term after convicting him of organizing the activities of a banned...
crimean tatar
https://bobthepainter.blogspot.com/2015/11/balaclava-initial-dispositions.html
20mm Crimean War Wargaming and Other Stuff: Balaclava - Initial Dispositions
The allied army has woken up, however redoubts 4 and 5 and Canrobert's Hill off to the east have already fallen to the Russians. A few Turki...
crimean warand otherwargamingstuffbalaclava
https://podcasts.ox.ac.uk/keywords/crimean-war
crimean war | University of Oxford Podcasts
university of oxfordcrimean warpodcasts
https://neilclark66.blogspot.com/2014/03/crimean-referendum-is-democracy-in.html?showComment=1395659303257
Neil Clark: Crimean referendum is democracy in action
You can read a new interview with me on RT.com on the Crimean referendum and the double standards of the US/UK/EU elite figures who called i...
neil clarkcrimeanreferendumdemocracyaction
https://bobthepainter.blogspot.com/2013/11/
20mm Crimean War Wargaming and Other Stuff: November 2013
crimean warand otherwargamingstuffnovember
https://cordis.europa.eu/programme/id/FP7_HEALTH.2010.2.3.3-3/en
Integrated disease-specific research on West Nile Virus infections, Chikungunya and/or Crimean...
west nile virus
https://www.commondreams.org/news/2016/08/11/high-alert-ukraine-and-russia-building-military-crimean-border
'High Alert': Ukraine and Russia Building Up Military at Crimean Border | Common Dreams
Feb 26, 2025 - 'The events are developing according to a pretty negative scenario. Neither side has any trust in the other.'
ukraine and russia
https://britishphotohistory.ning.com/profiles/blogs/list/tag/Crimean
Crimean - Blogs - British Photographic History
Information and discussion on all aspects of British photographic history ranging from exhibitions and museum news, publications, and jobs
crimeanblogsbritishphotographichistory
https://l10n.gnome.org/languages/crh/gnome-infrastructure/ui-part/
GNOME Infrastructure - Crimean Tatar
gnomeinfrastructurecrimeantatar
https://www.themoscowtimes.com/2022/08/05/the-fall-and-rise-of-crimean-tatar-arts-a78511
The Fall and Rise of Crimean Tatar Arts - The Moscow Times
May 19, 2026 - Crimean Tatar art has a long and rich history dating back to ancient times, and it is a pride and glory of the indigenous people of the Crimean peninsula....
the fallcrimean tatarriseartsmoscow
https://bobthepainter.blogspot.com/2022/12/25mm-warrior-french-infantry.html
20mm Crimean War Wargaming and Other Stuff: 25mm Warrior French Infantry
For the past few weeks I have been paint converting some Warrior French infantry into Nassau and Brunswick troops. yesterday I finished of...
crimean warand otherwargaming
https://bobthepainter.blogspot.com/
20mm Crimean War Wargaming and Other Stuff
crimean warand otherwargamingstuff
https://l10n.gnome.org/languages/crh/all/ui/
All modules - Crimean Tatar
all modulescrimeantatar
https://www.frontiersin.org/journals/cellular-and-infection-microbiology/articles/10.3389/fcimb.2023.1121163/full
Frontiers | Construction and evaluation of DNA vaccine encoding Crimean Congo hemorrhagic fever...
Crimean-Congo hemorrhagic fever virus (CCHFV) can cause severe hemorrhagic fever in humans and is mainly transmitted by ticks. There is no effective vaccine ...
construction and evaluation
https://www.rferl.org/a/crimea-ukraine-russia-tatars-detained-terror-charges/27730631.html
Four Crimean Tatars Held For 'Membership' In Banned Islamic Group
Russia-backed Crimean authorities have detained four Crimean Tatars on suspicion of being members of an Islamic group that is banned in Russia.
crimean tatarsfor membershipfourheldbanned
https://www.history.ox.ac.uk/the-crimean-moment-and-crucible-just-war-principles-of-peace-and-debates-in-victorian-wartime-though
The Crimean Moment and Crucible: Just War, Principles of Peace, and Debates in Victorian Wartime...
https://teaattrianon.blogspot.com/2025/11/45000-year-old-crimean-neanderthal.html
Tea at Trianon: 45,000-Year-Old Crimean Neanderthal
tea at trianonyear oldcrimeanneanderthal
https://l10n.gnome.org/languages/crh/all/doc/
All modules - Crimean Tatar
all modulescrimeantatar
https://l10n.gnome.org/languages/crh/gnome-50/ui/
GNOME 50 (stable) - Crimean Tatar
gnomestablecrimeantatar
https://journals.plos.org/plosntds/article?id=10.1371/journal.pntd.0006248
Host preferences support the prominent role of Hyalomma ticks in the ecology of Crimean-Congo...
Author summary Crimean-Congo hemorrhagic fever virus (CCHFV), a cause of severe hemorragic disease in humans, is maintained in nature in a tick-vertebrate-tick...
https://photo.kommersant.ru/photo/photo/192465/1500923
Volunteers during the Crimean clean-up event in Yalta, organized to clean up the resort town after...
All-Crimean subbotnik in Yalta, organized with the aim of eliminating the consequences of floods and overflowing the banks of the Vodopadnaya River on June 18,...
https://thecrimeanwar.com/
Footprints and memories of Crimean War in Istanbul, Paris, London and Turin
Today, when one travels the capital of the United Kingdom (London), of the France (Paris), of the Kingdom of Piedmont-Sardinia (Turin) and Istanbul (former...
crimean warfootprintsmemories
https://www.rferl.org/a/crimean_parliament_speaker_hrytsenko/2290847.html
More Criminal Charges Against Former Crimean Parliament Speaker
A second criminal case has been opened in Ukraine against former Crimean Parliament chairman Anatoliy Hrytsenko.
criminal chargesformercrimeanparliamentspeaker
https://abcwargamers.blogspot.com/2016/10/s-range-conversions-standing-firing.html
abc wargamers: S Range Conversions - Standing Firing Crimean War Infantry
ABC Wargamers is a blog about wargaming. The site features buildings and ships built by Jack Alexander as well as wargames.
s rangecrimean warabcconversionsstanding
https://open.library.ubc.ca/soa/cIRcle/collections/ubctheses/831/items/1.0092455
From Surgun to Vatan : ethnic identity construction and the repatriation processes of the Crimean...
Learning, knowledge, research, insight: welcome to the world of UBC Library, the second-largest academic research library in Canada.