Robuta

https://canonical.com/case-study/ubuntu-pro-support-for-games-developer Ubuntu Pro helps large games publisher secure code dependencies and avoid costly migration Securing open source dependencies with Ubuntu Pro — legacy PHP support saves a game developer time and effort, while they plan a migration path. ubuntu prohelpslargegamespublisher https://scientific-python.org/specs/spec-0000/ Scientific Python - SPEC 0 — Minimum Supported Dependencies Community developed and owned ecosystem for scientific computing scientific pythonspecminimumsupporteddependencies https://www.welivesecurity.com/en/business-security/supply-chain-dependencies-have-you-checked-your-blind-spot/ Supply chain dependencies: Have you checked your blind spot? Your biggest risk may be a vendor you trust. How can SMBs map their third-party blind spots and build operational resilience? supply chainblind spotdependencieschecked https://universaldependencies.org/ Universal Dependencies universaldependencies https://github.com/curl/curl/pull/21110 docs: list more dependencies for running Python HTTP tests by dfandrich · Pull Request #21110 ·... A command line tool and library for transferring data with URL syntax, supporting DICT, FILE, FTP, FTPS, GOPHER, GOPHERS, HTTP, HTTPS, IMAP, IMAPS, LDAP,... pull requestdocslistdependenciesrunning https://www.infoq.com/presentations/open-source-dependencies/ Empower Your Developers: How Open Source Dependencies Risk Management Can Unlock Innovation - InfoQ Apr 15, 2026 - Celine Pypaert discusses the ubiquitous nature of open-source software and shares a blueprint for securing modern applications. She explains how to prioritize... open sourcerisk managementempowerdevelopersdependencies https://support.atlassian.com/bitbucket-cloud/docs/specify-dependencies-in-your-pipelines-build/ Specify dependencies in your Pipelines build | Bitbucket Cloud | Atlassian Support Bitbucket Pipelines runs your builds in a Docker container that provides the build environment. There are a few ways you can specify any dependencies. bitbucket cloudatlassian supportspecifydependenciespipelines https://github.blog/security/supply-chain-security/do-you-know-if-all-your-repositories-have-up-to-date-dependencies/ Do you know if all your repositories have up-to-date dependencies? - The GitHub Blog Consider deploying the GitHub Action: Evergreen so that you know each of your repositories are leveraging active dependency management with Dependabot. do you knowup to dategithub blogrepositoriesdependencies https://bundlephobia.com/ Bundlephobia | Size of npm dependencies Bundlephobia helps you find the performance impact of npm packages. Find the size of any javascript package and its effect on your frontend bundle. sizenpmdependencies https://versions.deps.co/ Deps Versions: identify out of date dependencies Identifies out of date dependencies for Clojure projects hosted on GitHub out ofdepsversionsidentifydate https://jar-download.com/ Download JAR files with all dependencies Search and download Java libraries/JAR files inclusive their dependencies. ➤ No Maven installation ➤ Everything online ➤ Free download downloadjarfilesdependencies https://www.apachelounge.com/viewtopic.php?t=8609&start=0 Apache :: HOWTO: Building Apache and dependencies using CMake apachehowtobuildingdependenciesusing https://vlad.website/how-binary-dependencies-work/ How Binary Dependencies Work Across Different Languages Have you ever wondered how it’s possible to call C code from other languages like Python? Here are the technical details — and also why this topic is important... different languagesbinarydependenciesworkacross https://modemmanager.org/docs/libqrtr-glib/dependencies/ Dependencies | ModemManager Build and runtime dependencies of the libqrtr-glib library. dependenciesmodemmanager https://www.notion.com/help/tasks-and-dependencies Sub-items & dependencies – Notion Help Center Create and organize tasks in Notion to take your project management to the next level. Use sub-items and dependencies to give depth to any workflow 🐣 help centersubitemsdependenciesnotion https://www.academia.edu/165384525/Geometric_dependencies_of_vibronically_mediated_excitation_transfer_in_rylene_dyads (PDF) Geometric dependencies of vibronically mediated excitation transfer in rylene dyads Mar 29, 2026 - We study the excitation transfer in various geometric arrangements of rylene dimers using absorption, fluorescence and transient absorption spectra.... transfer inpdfgeometricdependencies Sponsored https://dateplayertwo.com/ Date Player 2 | The Gamer Dating Site Meet your player 2. Effortlessly browse through potential gamers, geeks & cosplayers. It's time to meet local gamers and find your final fantasy! Search by... https://help.smartsheet.com/learning-track/level-3-solutions/gantt-chart-dependencies Gantt Chart with Dependencies | Smartsheet Learning Center Create dependencies between tasks in your project. gantt chartlearning centerdependenciessmartsheet https://www.infoq.com/articles/architecting-autonomy-scale/ Architecting Autonomy at Scale: Raising Teams without Creating Dependencies - InfoQ Mar 27, 2026 - Modern engineering needs a shift from at scaleautonomyraisingteamswithout https://forgejo.org/docs/latest/contributor/repositories-dependencies/ Managing dependencies between repositories | Forgejo – Beyond coding. We forge. managing dependenciesrepositoriesforgejobeyondcoding https://askubuntu.com/questions/707333/how-to-debug-an-unmet-dependencies-problem apt - How to debug an unmet dependencies problem? - Ask Ubuntu Note about possible duplicate: AFAIK, This is not a duplicate of How do I resolve unmet dependencies after adding a PPA? otherwise please prove it by solving... how toask ubuntuaptdebugdependencies https://ubuntu.com/engage/securing-open-source-AI-with-Everything-LTS Securing open source AI dependencies with Everything LTS | Ubuntu Learn how this leading AI company relies on Canonical to secure over 2,500 open source dependencies open source aisecuringdependencieseverythinglts https://humanwhocodes.com/blog/2022/06/sponsoring-dependencies-open-source-sustainability/ Sponsoring dependencies: The next step in open source sustainability - Human Who Codes We are at a point in open source development where it's become clear that not all projects have the same opportunity to receive funding and maintainers are the... the next stepopen sourcesponsoringdependenciessustainability https://askubuntu.com/questions/tagged/dependencies?tab=Bounties Bountied 'dependencies' questions - Ask Ubuntu ask ubuntubountieddependenciesquestions https://nx.dev/docs/features/automate-updating-dependencies Automate Updating Dependencies | Nx Learn how to use Nx migrate to automatically update package dependencies, configuration files, and source code to match new package versions. updating dependenciesautomatenx https://forge.rust-lang.org/docs-rs/add-dependencies.html Adding dependencies to the build environment - Rust Forge Supplemental documentation for contributing to The Rust Programming Language the buildaddingdependenciesenvironmentrust https://www.aikido.dev/blog/sast-vs-sca SAST vs SCA Explained: Securing Your Code and Dependencies Jan 13, 2026 - earn how SAST and SCA differ, what risks each addresses, and why modern AppSec teams need both to secure code and dependencies. sastvsscaexplainedsecuring Sponsored https://darlink.ai/ DarLink AI: Free AI Girlfriend Generator | Chat, Photos & Video Create your ideal AI Girlfriend with DarLink AI. Customize her look and personality, chat naturally, and enjoy personalized photos, videos, and voice for a... https://lovable.dev/faq/design/systems-and-libraries Design Systems & Dependencies — Design & UI FAQ | Lovable design systemsdependenciesuifaqlovable https://emptyhammock.com/blog/download-dependencies-with-ant-and-ivy.html Download dependencies with Ant and Ivy downloaddependenciesantivy https://codeberg.org/gnuhealth/his-utils/issues/9 #9 - Include dependencies in gnuhealth control - gnuhealth/his-utils - Codeberg.org his-utils - Utilities for the GNU Health HIS server (gnuhealth-control, installer, interfaces...) includedependenciescontrolutilscodeberg https://gynvael.coldwind.pl/?id=477 Hello World in C without libraries or similar dependencies - gynvael.coldwind//vx.log hello worldgynvael coldwindwithoutlibrariessimilar https://www.perl.com/article/19/2013/4/15/Installing-Perl-modules-with-C-library-dependencies/ Installing Perl modules with C library dependencies How to tackle this tricky config issue installing perl moduleslibrarydependencies https://lea.verou.me/blog/2026/web-deps/ Web dependencies are broken. Can we fix them? • Lea Verou Dear JS ecosystem, I love you, but you have a dependency management problem when it comes to the Web, and the time has come for an intervention. lea verouwebdependenciesbrokenfix https://invent.kde.org/kde-linux/kde-linux/-/commit/aa17d0564526887cbc743f5a0bd395de2372b4ca Add a few optional dependencies of KDE software that we missed (aa17d056) · Commits · KDE Linux /... Found while auditing our dependencies. We generally follow the rule to pre-install optional dependencies (where it makes sense), so include these. They're all... addoptionaldependencieskdesoftware https://www.worldatlas.com/geography/dependencies-and-territories-of-the-world.html Dependencies And Territories Of The World May 18, 2021 - A dependency or dependent territory is a territory that is not fully independent or sovereign and also not fully part of an independent country. the worlddependenciesterritories https://doc.rust-lang.org/cargo/guide/dependencies.html Dependencies - The Cargo Book the cargodependenciesbook https://kriesi.at/support/topic/not-registered-dependencies-for-enfold-css-and-js/ Not registered dependencies for Enfold css and js - Support | Kriesi.at - Premium WordPress Themes premium wordpress themesregistereddependenciesenfoldcss https://askubuntu.com/questions/tagged/dependencies Newest 'dependencies' Questions - Ask Ubuntu ask ubuntunewestdependenciesquestions https://www.apachelounge.com/viewtopic.php?t=8609 Apache :: HOWTO: Building Apache and dependencies using CMake apachehowtobuildingdependenciesusing https://sammy.codific.com/browse/cybersecurity-fundamentals-20/govern/organizational-context/organizational-service-dependencies Organizational Service Dependencies from Cybersecurity Fundamentals 2.0 framework | SAMMY Explore Organizational Service Dependencies from Cybersecurity Fundamentals 2.0 with our comprehensive tool for managing compliance and maturity programs.... service dependenciescybersecurity fundamentals2 0organizationalframework https://developer.hashicorp.com/well-architected-framework/define-and-automate-processes/define/centralize-packages Centralize packages and dependencies | Well-Architected Framework | HashiCorp Developer Feb 4, 2026 - Centralize artifacts and dependencies with artifact managers to streamline builds, enhance security, and ensure consistent deployments across environments. centralizepackagesdependencieswellframework Sponsored https://www.bootycallz.com/ Booty Callz - World's Sexiest Black Hookup Dating @ BootyCallz.com https://curl.se/docs/libs.html curl - External Dependencies curlexternaldependencies https://docs.saltproject.io/salt/install-guide/en/latest/topics/install-dependencies.html Install dependencies - Salt install guide install dependenciessaltguide https://github.com/curl/curl/pull/20015 cmke: add `*_USE_STATIC_LIBS` options for 9 dependencies by vszakats · Pull Request #20015 ·... A command line tool and library for transferring data with URL syntax, supporting DICT, FILE, FTP, FTPS, GOPHER, GOPHERS, HTTP, HTTPS, IMAP, IMAPS, LDAP,... pull requestaddusestaticlibs https://www.apachelounge.com/viewtopic.php?t=8609&start=100 Apache :: HOWTO: Building Apache and dependencies using CMake apachehowtobuildingdependenciesusing https://www.tensorflow.org/api_docs/python/tf/control_dependencies tf.control_dependencies | TensorFlow v2.16.1 Wrapper for Graph.control_dependencies() using the default graph. tfcontroldependenciestensorflowv2 https://blogs.gnome.org/adrianvovk/2025/06/10/gnome-systemd-dependencies/ Introducing stronger dependencies on systemd – Adrian's blog PSA for systemd-free distros about work they'll need to do to continue running GNOME introducingstrongerdependenciessystemdadrian https://issuetracker.unity3d.com/issues/applying-duplicate-dependencies-in-package-manifest-throws-argumentexception-instead-of-preventing-applying-changes Unity Issue Tracker - Applying duplicate Dependencies in Package Manifest throws... Steps to reproduce:1. Create new Unity project2. Open Package Manager3. Create a new Package4. Select to edit new Package Manifest i... issue trackerunityapplyingduplicatedependencies https://www.learncpp.com/cpp-tutorial/dependencies/ 23.5 — Dependencies – Learn C++ learn cdependencies https://fastapi.tiangolo.com/advanced/advanced-dependencies/ Advanced Dependencies - FastAPI FastAPI framework, high performance, easy to learn, fast to code, ready for production advanced dependenciesfastapi https://developers.elementor.com/docs/form-fields/field-dependencies/ Field Dependencies | Elementor Developers Resources and tutorials for Elementor developers fielddependencieselementordevelopers https://mvnpm.org/ mvnpm - Use NPM packages as Maven/Gradle dependencies Seamlessly integrate NPM packages into Java through Maven and Gradle dependencies. The bridge between NPM and Maven Central. usenpmpackagesmavengradle Sponsored https://www.fanvue.com/maisxlife Mai - Fanvue I have a lot to show you. A little snapshot of what to expect on my page: everything. Come dm me so I can show you... https://packaging.python.org/en/latest/tutorials/managing-dependencies/ Managing Application Dependencies - Python Packaging User Guide user guidemanagingapplicationdependenciespython https://deps.rs/ Keep your dependencies up-to-date - Deps.rs up to datekeepdependenciesdepsrs https://www.herodevs.com/eol-dataset/overview End-of-Life Dataset (EOLDS) I Find Abandoned Open-Source Dependencies Your Scanner Misses | HeroDevs Discover unsupported and abandoned open-source software before it becomes a security risk. EOLDS tracks 11M+ package versions to reveal the lifecycle risks CVE... end of lifeopen sourcedatasetfindabandoned https://www.sonatype.com/products/sonatype-mcp-server Manage Dependencies with Sonatype's MCP Server | Sonatype Enhance your AI coding with Sonatype Guide's MCP server, ensuring secure, compliant dependencies for faster and more reliable software development. manage dependenciesmcp serversonatype https://launchpad.net/~wireshark-dev/+archive/ubuntu/wireshark-deps Wireshark dependencies : “Wireshark Developers” team Wireshark dependencies which are not available in standard Ubuntu releases wiresharkdependenciesteam https://go.dev/doc/tutorial/govulncheck Tutorial: Find and fix vulnerable dependencies with govulncheck - The Go Programming Language go programming languagetutorialfindfixvulnerable https://everything.curl.dev/build/deps.html Dependencies - everything curl everything there is to know about curl, libcurl and the cURL project everything curldependencies Sponsored https://www.secrets.ai/ Secrets AI - #1 Realistic AI Girlfriend Website for Chatting Chat 24/7 with realistic AI Girlfriend and enjoy 100+ Fantasies. Secrets AI is the best AI girlfriend website for mutual fun & personal AI companion bonding.... https://openjsf.org/blog/rsac-2026-robin-bender-ginn The Real Supply Chain Risk: Unsupported Dependencies, Overloaded Maintainers | OpenJS Foundation RSAC 2026 Brief from Robin Bender Ginn, Executive Director, OpenJS Foundation supply chain riskopenjs foundationrealunsupporteddependencies https://mvnpm.org/releases/ Releases - mvnpm - mvnpm - Use NPM packages as Maven/Gradle dependencies Track Maven Central sync status for NPM packages. Monitor packaging, uploading, and release stages. releasesusenpmpackagesmaven Sponsored https://darlink.ai/ DarLink AI: Free AI Girlfriend Generator | Chat, Photos & Video Create your ideal AI Girlfriend with DarLink AI. Customize her look and personality, chat naturally, and enjoy personalized photos, videos, and voice for a... https://viteplus.dev/guide/install Installing Dependencies | The Unified Toolchain for the Web The Unified Toolchain for the Web for webinstallingdependenciesunifiedtoolchain https://www.endorlabs.com/learn/surprise-your-github-actions-are-dependencies-too Surprise Your Github Actions Are Dependencies Too |… | Blog | Endor Labs Read Surprise Your Github Actions Are Dependencies Too and learn practical strategies for application security, risk prioritization, and faster… github actionsendor labssurprisedependenciesblog https://www.aikido.dev/blog/sca-in-ide-scan-and-fix-dependencies SCA in IDE: Scan and Fix Vulnerable Dependencies with AutoFix Jan 9, 2026 - Bring the full SCA workflow into your IDE with in-editor scanning and AutoFix. Detect vulnerable packages, review CVEs, and apply safe upgrades without leaving... scaidefixvulnerabledependencies https://nokodsecurity.com/use-cases/supply-chain-security/ Map Shadow IT, Hidden Dependencies & Connector Risk | Nokod Apr 5, 2026 - Identify supply chain risks early. Detect risky connectors, APIs, plugins, and shadow IT across enterprise low-code, no-code apps, and AI agents. shadow itmaphiddendependenciesconnector https://drewdevault.com/blog/Dependencies-and-maintainers/ Dependencies and maintainers dependenciesmaintainers https://www.red-gate.com/products/sql-dependency-tracker/ SQL Dependency Tracker: See SQL Server Object Dependencies Visualize MS SQL Server object dependencies with Redgate SQL Dependency Tracker - try it free for 14 days. sql dependency trackerseeserverobjectdependencies https://mvnpm.org/composites/ Composites - mvnpm - mvnpm - Use NPM packages as Maven/Gradle dependencies Browse and manage composite packages that aggregate multiple NPM packages into a single Maven artifact. compositesusenpmpackagesmaven Sponsored https://www.sakuralive.com/ Japanese Webcam | Chat with Sexy Japanese Cam Girls Online Video Chat with Sexy Japanese Webcam Girls Online right now. With over 22k+ plus registered performers, you are sure to find one that you'll like. Don't wait,... https://www.manning.com/livevideo/talk-python-managing-python-dependencies Talk Python: Managing Python Dependencies - Dan Bader Talk Python: Managing Python Dependencies is part of the exciting Talk Python course series. This video is aimed at Python programmers who want to become more... talk pythonmanaging dependenciesdan https://fastapi.tiangolo.com/tutorial/dependencies/dependencies-in-path-operation-decorators/ Dependencies in path operation decorators - FastAPI FastAPI framework, high performance, easy to learn, fast to code, ready for production dependenciespathoperationdecoratorsfastapi https://www.ansa.it/english/news/2026/04/24/eu-protein-plan-due-in-june-hansen-says-it-will-reduce-dependencies_f2b8127f-3453-4f6a-b3f0-4206e27a3263.html EU protein plan due in June, Hansen says it will reduce dependencies - TopNews - Ansa.it The European Commission will present in juneeuproteinplandue