https://hgcannabisco.com/
HG Cannabis Co. – Premium THCA & Hemp-Derived Products
hgcannabiscopremiumthca
https://www.fda.gov/news-events/public-health-focus/fda-regulation-cannabis-and-cannabis-derived-products-including-cannabidiol-cbd
FDA Regulation of Cannabis and Cannabis-Derived Products, Including Cannabidiol (CBD) | FDA
Questions and answers about FDA regulation of cannabis and cannabis-derived products
regulation of cannabisderived productsfdaincludingcannabidiol
https://www.worlddanceorganisation.com/
World Dance Organisation – The WDO derived from the collective desires of many competitors,...
https://alegrialivingsoil.com/
Alegría Living Soil | Alegría Living Soil is blended with 100% organic inputs and naturally-derived...
living soil
https://wizardofodds.com/games/craps/appendix/1/
How the House Edge for Each Bet is Derived
the house edgefor eachbetderived
https://shopwanderous.com/
Wanderous | The first online marketplace for hemp-derived wellness products
Jul 14, 2026 - Whether you're looking for better sleep or energy, inspiration or calm, gummies or beverages, start your journey here. Welcome to Wanderous!
the firstonline marketplacehempderivedwellness
https://thehoneypot.co/
Plant-Derived Feminine Care | Female Hygiene - Honey Pot Feminine Care – The Honey Pot - Feminine...
Say hello to the future of feminine care with our natural washes, wipes and pads. The Honey Pot seeks to promote female health through plant-derived products.
feminine carefemale hygienehoney potplantderived
https://www.eodyn.com/
AIS derived surface currents | eOdyn
Feb 14, 2025 - eOdyn - In Situ Ocean Surface Currents Anytime, in Every Ocean.
aisderivedsurfacecurrents
https://international-cdp.com/
5th Cannabinoid-Derived Pharmaceuticals Summit | Boston, MA
Jul 12, 2022 - The world’s largest conference devoted exclusively to the production of CDPs for medical conditions using FDA/EMA approval pathways
cannabinoidderivedpharmaceuticalssummitboston
https://cannpowerment.com/
Cannpowerment - Cannabis Derived Products, Contract Manufacturing
contract manufacturing, cannabis, new jersey
derived productscannabiscontractmanufacturing
https://hereticparfum.com/
Naturally Derived Fragrance by Heretic Parfum – HERETIC PARFUM
Discover handcrafted fragrance made from 100% naturally derived botanical ingredients blended in organic sugarcane alcohol. Unisex, vegan, and cruelty-free...
naturally derivedheretic parfumfragrance
https://www.bathymetrics.shop/
Bathymetrics Data Portal - Satellite-Derived Bathymetry Data | DHI Group
With DHI's Bathymetrics Data Portal, you can download high-quality bathymetry data to support your environmental and feasibility studies.
data portalbathymetricssatellitederivedbathymetry
https://arxiv.org/abs/2506.06616
[2506.06616] Interpretable Depression Detection from Social Media Text Using LLM-Derived Embeddings
Abstract page for arXiv paper 2506.06616: Interpretable Depression Detection from Social Media Text Using LLM-Derived Embeddings
from social media
https://www.cancermodels.org/
Cancer Models: Patient-Derived Xenografts, Organoids, Cells
Discover the largest catalog of patient-derived xenograft, organoid, and cell cancer models for your next project.
cancer modelspatientderivedxenograftsorganoids
https://en.wiktionary.org/wiki/Category:Middle_Assamese_terms_derived_from_Magadhi_Prakrit
Category:Middle Assamese terms derived from Magadhi Prakrit - Wiktionary, the free dictionary
https://videos.thermofisher.com/detail/videos/stem-cell-research/video/6216118258001
Modelling disorders of the brain through patient-derived stem cells - Stem Cell Research -...
This presentation discusses the 3D drug discovery pipeline, focused on translating findings from 2D neurons, into 3D brain organoids.
of the
https://pubmed.ncbi.nlm.nih.gov/20129486/
Open-labeled study of unilateral autologous bone-marrow-derived mesenchymal stem cell...
Parkinson's disease (PD) is a progressive neurodegenerative disease for which stem cell research has created hope in the last few years. Seven PD patients aged...
https://iris.cnr.it/handle/20.500.14243/301330
Clinical impact of the immunome in lymphoid malignancies: The role of myeloid-derived suppressor...
clinical impactof the
https://pubmed.ncbi.nlm.nih.gov/35411230/
Stat5b inhibition blocks proliferation and tumorigenicity of glioblastoma stem cells derived from a...
Glioblastoma (GBM) is the most common and malignant type of brain cancer in adults with poor prognosis. GBM stem cells (GSCs) reside within niches in GBM...
https://cmgds.marine.usgs.gov/catalog/whcmsc/open_file_report/ofr2012-1006/VS_5mCntr_V2.html
Bathymetric depth contours at 5 meter intervals derived from interferometric sonar data collected...
https://en.wiktionary.org/wiki/Category:Gallurese_terms_derived_from_Vulgar_Latin
Category:Gallurese terms derived from Vulgar Latin - Wiktionary, the free dictionary
the freecategorygalluresetermsderived
https://alfred.stlouisfed.org/series?seid=RGDPL2UAA625NUPN
Purchasing Power Parity Converted GDP Per Capita (Laspeyres), derived from growth rates of domestic...
Graph and download revisions to economic data for from 1993 to 2010 about Ukraine, PPP, domestic, per capita, GDP, and rate.
purchasing power parity
https://publica.fraunhofer.de/entities/publication/55a4bc16-2aac-4124-b0a5-720e8edd108f
Phenolic resins derived from medium boiling fraction of fast pyrolysis oil - application as wood...
The general potential applicability of the medium condensing fraction of fast pyrolysis vapors as substitute for phenol in Phenol-Formaldehyde-resins in wood...
https://www.nist.gov/publications/derived-piv-application-and-data-model-test-guidelines
Derived PIV Application and Data Model Test Guidelines | NIST
Oct 14, 2021 - NIST Special Publication (SP) 800-157 contains technical guidelines for the implementation of standards-based, secure, reliable, interoperable Public Key Infras
data modeltest guidelinesderivedpivapplication
https://www.news-medical.net/news/20220309/Mushroom-derived-compounds-have-potential-for-use-as-COVID-19-therapeutic.aspx
Mushroom-derived compounds have potential for use as COVID-19 therapeutic
Mar 9, 2022 - Researchers conducted virtual screening and validation of molecules derived from mushrooms for their activity against the main protease SARS-CoV-2.
mushroomderivedcompoundspotential
https://cvvr.hms.harvard.edu/publication/cross-neutralizing-activity-of-human-anti-v3-monoclonal-antibodies-derived-from-non-clade-b-hiv-1-infected-individuals/
Cross-neutralizing activity of human anti-V3 monoclonal antibodies derived from non-clade B HIV-1...
https://pubmed.ncbi.nlm.nih.gov/37792944/
Simultaneous subset tracing and miRNA profiling of tumor-derived exosomes via dual-surface-protein...
The clinical potential of miRNA-based liquid biopsy has been largely limited by the heterogeneous sources in plasma and tedious assay processes. Here, we...
https://pubs.rsc.org/en/Content/ArticleLanding/2026/RA/D6RA00921B
Sodium alginate-derived hydrophilic Gel@CuO microspheres: a green nanocatalyst for diverse Petasis...
A sustainable heterogeneous catalytic system based on sodium alginate-derived Gel@CuO microspheres has been developed for Petasis multicomponent reactions...
https://cds.climate.copernicus.eu/datasets/derived-utci-historical?tab=overview
Thermal comfort indices derived from ERA5 reanalysis
This dataset provides a complete historical reconstruction for a set of indices representing human thermal stress and discomfort in outdoor conditions. This...
thermal comfortindicesderivedreanalysis
https://collections.nlm.nih.gov/catalog/nlm:nlmuid-101584926X106-doc
A Proposal for Naming Host Cell Derived Inserts in Retrovirus Genomes - Digital Collections -...
https://digital.library.adelaide.edu.au/items/2408345e-5762-4d44-88b9-967ee3394b0d
Relationship of television time with accelerometer-derived sedentary time: NHANES
Purpose: To examine the relationship of self-reported television (TV) viewing time with accelerometer-derived total sedentary time and to determine whether it...
relationshiptelevisiontimeaccelerometerderived
https://boris-portal.unibe.ch/entities/publication/21242331-3c39-472b-8720-5701d7fa194b
Correction: An oncogene addiction phosphorylation signature and its derived scores inform tumor...
https://www.cms.gov/medicare-coverage-database/view/ncacal-tracking-sheet.aspx?ncaid=172
NCA - Non-Autologous Blood Derived Products for Chronic Non-Healing Wounds (CAG-00190R) - Tracking...
Use this page to view the details for the NCA - Non-Autologous Blood Derived Products for Chronic Non-Healing Wounds (CAG-00190R) - Tracking Sheet
https://forge.engineering.asu.edu/furiproject/evaluation-of-algae-derived-carbon-adsorbents-for-direct-co2-capture-from-ambient-air/
Evaluation of Algae-Derived Carbon Adsorbents for Direct CO2 Capture from Ambient Air - Fulton...
Mar 24, 2021 - One potential solution to the looming threat of radical global warming is carbon capture with algae-derived carbon adsorbents because of their low production...
https://repository.lib.ncsu.edu/items/ae1ba968-b9b6-4be2-9a15-59df0ab3f032
Design, Synthesis, and Biological Evaluation of Novel Anti-Biofilm Molecules Derived from the...
Bacterial biofilms are a surface attached community of microorganisms that are protected by an extracellular matrix of biomolecules. Within a biofilm state,...
https://pure.psu.edu/en/publications/expression-of-pigment-epithelium-derived-factor-in-normal-adult-r/fingerprints/
Expression of pigment epithelium-derived factor in normal adult rat eye and experimental choroidal...
https://pmc.ncbi.nlm.nih.gov/articles/PMC11903755/
The role of myeloid-derived suppressor cells in children - PMC
Myeloid-derived suppressor cells (MDSC) were first recognized over twenty years ago as a key immunomodulatory cell population. Since their initial...
the rolein childrenmyeloidderivedsuppressor
https://www.nohrsc.noaa.gov/special/leaflet/2019/20190506_Davenport/index.html
Sentinel-1A and Sentinel-2A Derived Imagery of Iowa and the Mississippi River, 4 & 6 May, 2019
https://istina.msu.ru/publications/article/396309674/
Cyclopentadienyl lanthanide borohydrides derived from the unsubstituted cyclopentadienyl ligand....
from theborohydridesderived
https://en.wiktionary.org/wiki/Category:Sanskrit_terms_derived_from_the_Proto-Indo-Aryan_root_*Has-
Category:Sanskrit terms derived from the Proto-Indo-Aryan root *Has- - Wiktionary, the free...
https://www.gov.uk/research-for-development-outputs/locally-derived-knowledge-of-soil-fertility-and-its-emerging-role-in-integrated-natural-resource-management-54097
Locally derived knowledge of soil fertility and its emerging role in integrated natural resource...
https://en.wiktionary.org/wiki/Category:Sudanese_Arabic_terms_derived_from_Medieval_Latin
Category:Sudanese Arabic terms derived from Medieval Latin - Wiktionary, the free dictionary
sudanese arabic
https://collaborate.princeton.edu/en/publications/leaching-of-polycyclic-aromatic-hydrocarbons-pahs-from-sewage-slu/
Leaching of polycyclic aromatic hydrocarbons (PAHs) from sewage sludge-derived biochar - Princeton...
aromatic hydrocarbons
https://openresearch-repository.anu.edu.au/items/1de5b429-7110-46a1-a950-8a35fe04a8b6
Modular total syntheses of the marine-derived resorcylic acid lactones cochliomycins A and B using...
The natural products cochliomycin A (1) and cochliomycin B (2), two resorcylic acid lactones obtained from marine sources, have been prepared in a concise and...
https://www.earthdata.nasa.gov/fr/data/catalog/ornl-cloud-annual-landcover-above-1691-1
ABoVE: Landsat-derived Annual Dominant Land Cover Across ABoVE Core Domain, 1984-2014 | NASA...
ABoVE: Landsat-derived Annual Dominant Land Cover Across ABoVE Core Domain, 1984-2014
https://www.frontiersin.org/journals/cardiovascular-medicine/articles/10.3389/fcvm.2021.778010/full
Frontiers | Prognostic Value of Coronary CT Angiography-Derived Fractional Flow Reserve in...
Coronary artery disease (CAD) is a major contributor to morbidity and mortality worldwide. Myocardial ischemia may occur in patients with normal or non-obstr...
coronary ct angiography
https://research.ibm.com/publications/mo-theory-of-ease-of-formation-of-carbocations-derived-from-nonalternant-polycyclic-aromatic-hydrocarbons
MO Theory of Ease of Formation of Carbocations Derived from Nonalternant Polycyclic Aromatic...
MO Theory of Ease of Formation of Carbocations Derived from Nonalternant Polycyclic Aromatic Hydrocarbons for JACS by John P. Lowe et al.
motheoryeaseformation
https://profiles.wustl.edu/en/publications/brain-derived-neurotrophic-factor-dysregulation-as-an-essential-p/fingerprints/?sortBy=alphabetically
Brain-Derived Neurotrophic Factor Dysregulation as an Essential Pathological Feature in...
brainderivedfactordysregulation
https://pmc.ncbi.nlm.nih.gov/articles/PMC12119358/
Author Correction: Microbiota-derived 3-IAA influences chemotherapy efficacy in pancreatic cancer -...
https://espo.nasa.gov/atom/content/Effective_lidar_ratios_of_dense_dust_layers_over_North_Africa_derived_from_the_CALIOP
Effective lidar ratios of dense dust layers over North Africa derived from the CALIOP measurements...
https://research.rug.nl/nl/datasets/additional-file-19-of-the-hibernation-derived-compound-sul-138-sh/publications/
Additional file 19 of The hibernation-derived compound SUL-138 shifts the mitochondrial proteome...
https://walleindustry.en.made-in-china.com/product/KdYaLSgOEwtf/China-Automatic-Waste-Tire-Shredder-for-Tire-Derived-Fuel.html
Automatic Waste Tire Shredder for Tire Derived Fuel - Tire Recycling Amchine and Waste Tire Shredder
Automatic Waste Tire Shredder for Tire Derived Fuel, Find Details and Price about Tire Recycling Amchine Waste Tire Shredder from Automatic Waste Tire Shredder...
tire shredderautomaticwastederivedfuel
https://pmc.ncbi.nlm.nih.gov/articles/PMC9185767/
C-Phycocyanin-derived Phycocyanobilin as a Potential Nutraceutical Approach for Major...
The edible cyanobacterium Spirulina platensis and its chief biliprotein C-Phycocyanin have shown protective activity in animal models of diverse human health...
as acderived
https://scholars.unh.edu/ccom/223/
"Error Estimation of Bathymetric Grid Models Derived from Historic and " by Martin Jakobsson, Brian...
The past century has seen remarkable advances in technologies associated with positioning and the measurement of depth. Lead lines have given way to single...
https://www.mdpi.com/2227-9059/10/2/253
Human Hair Follicle-Derived Mesenchymal Stromal Cells from the Lower Dermal Sheath as a Competitive...
Mesenchymal stromal cells (MSCs) have unique immunomodulatory capacities. We investigated hair follicle-derived MSCs (HF-MSCs) from the dermal sheath, which...
https://pubmed.ncbi.nlm.nih.gov/36963360/
Taraxacum officinale-derived exosome-like nanovesicles modulate gut metabolites to prevent...
T. officinale-derived ELNs were effective in the treatment of IH-induced hypertensive disease, whereas butyrate played a major role in mediating the effects of...
taraxacum officinalegut metabolitesderivedexosomelike
https://experts.colorado.edu/display/pubid_337763
Experimentally Derived Luminous Efficiencies for Aluminum and Iron at Meteoric Speeds | CU Experts...
https://bibliographie.uni-tuebingen.de/xmlui/handle/10900/149491
Early decrease of blood myeloid-derived suppressor cells during checkpoint inhibition is a...
https://uk.mathworks.com/help/pde/ug/pde.transientstructuralresults.html
TransientStructuralResults - Transient structural solution and derived quantities - MATLAB
A TransientStructuralResults object contains the displacement, velocity, and acceleration in a form convenient for plotting and postprocessing.
transientstructuralsolutionderivedquantities
https://bibliographie.uni-tuebingen.de/xmlui/handle/10900/74886
Modeling of hematopoiesis using ES and patients-derived iPS cells
modelinghematopoiesisusingpatientsderived
https://researchconnect.buffalo.edu/en/publications/hydrogen-fluoride-phase-behavior-and-molecular-structure-ab-initi/
Hydrogen fluoride phase behavior and molecular structure: Ab initio derived potential models - SUNY...
https://nhess.copernicus.org/articles/22/1437/2022/nhess-22-1437-2022-relations.html
NHESS - Relations - Gridded flood depth estimates from satellite-derived inundations
Abstract. Canada's RADARSAT missions improve the potential to study past flood events; however, existing tools to derive flood depths from this remote-sensing...
nhessrelationsgriddedflooddepth
https://acp.copernicus.org/articles/20/10441/2020/
ACP - Comparing secondary organic aerosol (SOA) volatility distributions derived from isothermal...
Abstract. The volatility distribution of the organic compounds present in secondary organic aerosol (SOA) at different conditions is a key quantity that has to...
acpcomparingsecondaryorganicaerosol
https://cds.climate.copernicus.eu/datasets/sis-ecde-climate-indicators?tab=overview
Climate indicators for Europe from 1940 to 2100 derived from reanalysis and climate projections
This dataset provides a series of climate indices derived from reanalysis and model simulations data hosted on the Copernicus Climate Data Store (CDS). These...
climate indicatorsfor europe
https://ghc.gitlab.haskell.org/ghc/doc/users_guide/exts/newtype_deriving.html
6.6.5. Generalised derived instances for newtypes — Glasgow Haskell Compiler 9.15.20260306 User's...
https://pubs.rsc.org/en/content/articlelanding/2019/sc/c9sc03570b
New sulfuryl fluoride-derived alkylating reagents for the 1,1-dihydrofluoroalkylation of thiols -...
Herein, we report a new method for the one-pot synthesis of 1,1-dihydrofluoroalkyl sulfides by bubbling sulfuryl fluoride (SO2F2) through a solution of the...
sulfuryl fluoride
https://www.earthdata.nasa.gov/fr/data/catalog/larc-cloud-mop02j-109
MOPITT Beta Derived CO (Near and Thermal Infrared Radiances) V109 | NASA Earthdata
MOPITT Beta Derived CO (Near and Thermal Infrared Radiances) V109
https://www.jstage.jst.go.jp/article/rssj/35/4/35_245/_article
Evaluation and Improvement of MODIS and SeaWIFS-derived Chlorophyll a Concentration in Ise-Mikawa...
Access full-text academic articles: J-STAGE is an online platform for Japanese academic journals.
https://pmc.ncbi.nlm.nih.gov/articles/PMC6576083/
Multipotent fetal-derived Cdx2 cells from placenta regenerate the heart - PMC
There is a critical need to identify accessible stem cells that can form spontaneously beating cardiomyocytes (CMs) and enable regeneration. Here, we establish...
the heartfetalderivedcells
https://pmc.ncbi.nlm.nih.gov/articles/PMC8026476/
Self-organization of organoids from endoderm-derived cells - PMC
Organoids constitute biological systems which are used to model organ development, homeostasis, regeneration, and disease in vitro and hold promise for use in...
self organizationorganoidsendodermderivedcells
https://scholars.uky.edu/es/publications/prenatal-alcohol-exposure-triggers-ceramide-induced-apoptosis-in-/
Prenatal alcohol exposure triggers ceramide-induced apoptosis in neural crest-derived tissues...
https://impact.ornl.gov/en/publications/comparison-of-eco-friendly-ionic-liquids-and-commercial-bio-deriv/
Comparison of Eco-Friendly Ionic Liquids and Commercial Bio-Derived Lubricant Additives in Terms of...
https://data.mendeley.com/datasets/46k66mz9sz/5
UAV-derived waterfowl thermal imagery dataset - Mendeley Data
This dataset is the research data for: Accurately Wildlife Censusing by Using Deep Learning for UAV-Based Thermal Imageries
thermal imageryuavderivedwaterfowldataset
https://experts.arizona.edu/en/publications/echocardiographic-derived-pulmonary-artery-wedge-pressure-is-asso/
Echocardiographic derived pulmonary artery wedge pressure is associated with mortality, heart...
is associated withderivedpulmonaryarterywedge
https://scholars.duke.edu/publication/693777
Scholars@Duke publication: Phosphorylation of the platelet-derived growth factor receptor-beta and...
https://www.earthdata.nasa.gov/data/catalog/ornl-cloud-avhrr-fire-products-1545-1
ABoVE: AVHRR-Derived Forest Fire Burned Area-Hot Spots, Alaska and Canada, 1989-2000 | NASA...
ABoVE: AVHRR-Derived Forest Fire Burned Area-Hot Spots, Alaska and Canada, 1989-2000
https://en.wiktionary.org/wiki/Category:Norwegian_terms_derived_from_Semitic_languages
Category:Norwegian terms derived from Semitic languages - Wiktionary, the free dictionary
semitic languagesthe freecategorynorwegianterms
https://pure.lib.usf.edu/en/publications/mapping-forest-leaf-area-index-using-reflectance-and-textural-inf-2/
Mapping Forest Leaf Area Index using Reflectance and Textural Information derived from WorldView-2...
https://infoscience.epfl.ch/entities/publication/fe69f693-d49e-439a-85ff-59470216d818
MR derived volumetric flow rate waveforms of internal carotid artery in patients treated for...
Little is known about the hemodynamic disturbances induced by the cerebral aneurysms in the parent artery and the effect of flow diverter stents (FDS) on these...
https://ocw.mit.edu/courses/6-041-probabilistic-systems-analysis-and-applied-probability-fall-2010/resources/lecture-11-derived-distributions-convolution-correlation/
Lecture 11: Derived Distributions; Convolution; Covariance and Correlation | Probabilistic Systems...
MIT OpenCourseWare is a web based publication of virtually all MIT course content. OCW is open and available to the world and is a permanent MIT activity
lecturederiveddistributionsconvolutioncovariance
https://pubmed.ncbi.nlm.nih.gov/36713791/
Pain Alleviating Effect of Adipose-Derived Stem Cells Transplantation on the Injured Spinal Cord: A...
Few studies are conducted on the efficacy of human adipose-derived stem cells (ADSCs) in spinal cord injury (SCI) management and electrophysiological changes...
https://www.techtransfer.nih.gov/patent/e-240-2015-1-fr-07
Methods of Analyzing Virus-Derived Therapeutics | Technology Transfer
methodsanalyzingvirusderivedtherapeutics
https://infoscience.epfl.ch/entities/publication/5b2b8d1e-9d5a-45d2-9c18-427693ec28e3
Metabolic correction in oligodendrocytes derived from metachromatic leukodystrophy mouse model by...
In an effort to develop an encapsulated cell-based system to deliver arylsulfatase A (ARSA) to the central nervous system of metachromatic leukodystrophy (MLD)...
metachromatic leukodystrophymouse modelmetaboliccorrectionderived
https://espo.nasa.gov/ashoe_maesa/content/Effective_Radius_of_Ice_Cloud_Particle_Populations_Derived_from_Aircraft_Probes
Effective Radius of Ice Cloud Particle Populations Derived from Aircraft Probes | ASHOE-MAESA
https://arxiv.org/abs/2604.24164
[2604.24164] A Bornological Perspective on the Representability of Derived Moduli Stacks of...
Abstract page for arXiv paper 2604.24164: A Bornological Perspective on the Representability of Derived Moduli Stacks of Solutions to PDEs
on the
https://en.wiktionary.org/wiki/Category:French_terms_derived_from_Japanese
Category:French terms derived from Japanese - Wiktionary, the free dictionary
the freecategoryfrenchtermsderived
https://www.frontiersin.org/journals/neuroanatomy/articles/10.3389/fnana.2012.00036/full
Frontiers | A compact and realistic cerebral cortical layout derived from prewhitened resting-state...
We used hierarchical tree clustering to derive a functional organizational chart of 52 human cortical areas (26 per hemisphere) from zero-lag correlations ca...
https://research.utwente.nl/en/publications/regeneration-of-articular-cartilage-by-adipose-tissue-derived-mes/
Regeneration of articular cartilage by adipose tissue derived mesenchymal stem cells: Perspectives...
adipose tissue derivedmesenchymal stem cellsarticular cartilage
https://acp.copernicus.org/articles/16/7605/2016/
ACP - Climatological and radiative properties of midlatitude cirrus clouds derived by automatic...
https://research-portal.st-andrews.ac.uk/en/publications/one-century-of-information-diffusion-in-the-netherlands-derived-f/datasets/
One century of information diffusion in the Netherlands derived from a massive digital archive of...
https://scholars.lib.ntu.edu.tw/entities/publication/438c5bd2-40a5-4f75-9068-ecce565aed49
Effects of Increased and Oxygen on the Growth Rate of Cultured Endothelial Cells Derived from Human...
https://pubmed.ncbi.nlm.nih.gov/38744290/
A platform for rapid patient-derived cutaneous neurofibroma organoid establishment and screening
Localized cutaneous neurofibromas (cNFs) are benign tumors that arise in the dermis of patients affected by neurofibromatosis type 1 syndrome. cNFs are benign...
https://acp.copernicus.org/articles/22/14189/2022/acp-22-14189-2022-discussion.html
ACP - Peer review - Satellite-derived constraints on the effect of drought stress on biogenic...
Abstract. While substantial progress has been made to improve our understanding of biogenic isoprene emissions under unstressed conditions, large uncertainties...
https://www.cirm.ca.gov/about-cirm/publications/developing-hypoimmunogenic-human-ipsc-derived-oligodendrocyte-progenitor-cells-shelf-cell-therapy-myelin-disorders/
Developing Hypoimmunogenic Human iPSC-Derived Oligodendrocyte Progenitor Cells as an Off-The-Shelf...
https://userapps.support.sap.com/sap/support/knowledge/en/2125958
2125958 - Derived Business Transactions are not fully generated for securities positions | SAP...
Securities positions handled in Transaction Manager for Treasury and Risk Management. Within a created position there are business transactions like sale,...
business transactionsare not
https://www.scirp.org/journal/paperinformation?paperid=60727
Effect of Pyrolysis Temperature on the Electrical Behavior of Polymer-Derived SiOCN Ceramic
Discover the impact of pyrolysis temperature on the conductivity of SiOCN ceramics. Explore the role of dangling bonds on graphite-like carbon in enhancing...
on the
https://angeo.copernicus.org/articles/24/851/2006/angeo-24-851-2006.html
ANGEO - A study of the ionogram derived effective scale height around the ionospheric hmF2
Abstract. The diurnal, seasonal, and solar activity variations of the ionogram derived scale height around the ionospheric F-layer peak (Hm) are statistically...
https://iscrm.uw.edu/recent_research/sars-cov-2-infects-human-pluripotent-stem-cell-derived-cardiomyocytes-impairing-electrical-and-mechanical-function/
SARS-CoV-2 Infects Human Pluripotent Stem Cell-Derived Cardiomyocytes, Impairing Electrical and...
Jan 18, 2022 - Stem Cell Reports, March 2021
https://www.frontiersin.org/journals/nutrition/articles/10.3389/fnut.2023.1233086/full
Frontiers | Genetic liability for diet-derived circulating antioxidants, oxidative stress, and risk...
Background: Though well-documented, the causal relationships between diet-derived circulating antioxidants, oxidative stress, and osteoarthritis (OA) are equ...
https://pubmed.ncbi.nlm.nih.gov/31980879/
Human umbilical cord blood-derived mesenchymal stem cell implantation for osteoarthritis of the knee
hUCB-MSC implantation regenerated cartilage satisfactorily and showed satisfactory clinical outcomes in patients older than 60 years who had MC osteoarthritis.