https://schuylerbrown.substack.com/
The Art of Emergence | Schuyler Brown | Substack
An offering of mandalas, meditations, poetry and wisdom. Click to read The Art of Emergence, by Schuyler Brown, a Substack publication with thousands of...
the art ofschuyler brownemergencesubstack
https://embodied-intelligence.org/
Embodied Intelligence | …creating an community to understand the emergence of physical intelligence
...creating an community to understand the emergence of physical intelligence
embodied intelligenceto understandthe emergencecommunity
https://redes-ecovillages.org/
Home - REDES : Réseau pour l'Emergence et le Développement des Ecovillages au Sahel
Jul 8, 2026 - Strengthening communities, healing the land, rebuilding economies since 2015. REDES Reseau pour l'Emergence et le Développement des Ecovillages au Sahel...
https://en.wikipedia.org/wiki/Emergence
Emergence - Wikipedia
emergencewikipedia
https://ddaoccitanie-emergence.org/
Documents d’artistes Occitanie - Emergence
Documents d’artistes Occitanie - Emergence
documentsoccitanieemergence
https://emergencehealthnetwork.org/employment/
Employment – Emergence Health Network
employmentemergencehealthnetwork
https://civilizationresearchinstitute.org/
The Civilization Research Institute works to support the emergence of a mature global civilization
the civilizationresearch instituteto support
https://www.emsoft.com/
Emergence
Emergence is a dedicated permanent equity partner backed by The Pritzker Organization. We partner with high-potential software companies to provide long-term...
emergence
https://www.ethicalmarkets.com/
EthicalMarkets.com | Supporting the emergence of a sustainable, green, ethical and a just economy...
https://elisa.tshdresearch.org/
Emergence of Language in Social Interaction (ELISA) – ERC Starting Grant Project
erc starting grantsocial interaction
https://www.emergence-architectes.fr/
Emergence Architectes | Home
Emergence est un cabinet d'architecte...
emergencearchitectes
https://emergencemagazine.org/
Connecting the threads between ecology, culture, and spirituality – Emergence Magazine
Jun 25, 2026 - Emergence Magazine is an online publication with an annual print edition connecting the threads between ecology, culture, and spirituality.
culture and spiritualityconnectingthreadsecology
https://www.emcap.com/thoughts/technology-for-the-deskless-workforce
Introducing "The State of Technology for the Deskless Workforce" | Emergence Capital
the stateintroducingtechnologydesklessworkforce
https://erictopol.substack.com/p/the-emergence-of-protein-organ-clocks
The Emergence of Protein Organ Clocks - by Eric Topol
Predicting and Tracking Organ-Specific Aging, Health and Disease
the emergenceby ericproteinorganclocks
https://collectif-emergence.fr/
Collectif Emergence - Les créateurs de mode des pays de la Loire
Jan 12, 2026 - Le collectif Emergence fédère depuis 2004 les créateurs de mode et accessoires de mode des pays de la Loire.
collectif emergencede modedes payslesla
https://humanemergence.de/
Startseite - Center for Human Emergence
center forstartseitehumanemergence
https://emergence-international.org/conferences/
Conferences | Emergence International
conferencesemergenceinternational
https://brazosvalleytxcert.samariteam.com/
Brazos Valley Community Emergence Response Teams (CERT) - HOME
brazos valleyresponse teamscommunityemergencecert
https://arxiv.org/abs/2507.04951
[2507.04951] What is emergence, after all?
Abstract page for arXiv paper 2507.04951: What is emergence, after all?
what isemergence
https://emergence.alsace/
Accueil - EMERGENCE
Mar 23, 2026 - Le dispositif EMERGENCE couvre le territoire du Bas-Rhin et entre dans le cadre du Contrat Engagements Jeunes en rupture
accueilemergence
https://theemergencestudio.teachable.com/p/table-talk-for-boards-essential-conversations1
Table Talk for Boards | Essential Conversations | The Emergence
Table Talk for Boards is a 12-session, drop-in style training series for nonprofit leaders -- board members, chairs, committee leaders, executive directors....
table talkfor boardsessential conversationsemergence
https://emergence.xyz/
emergence
The premier conference on crypto's collective future.
emergence
https://www.emergence.asia/
Emergence by ASN — Matching Support For Startups
Find the right mentor, advisor, investor or fractional for your startup. Powered by Asia Startup Network.
support foremergenceasnmatchingstartups
https://www.diva-portal.org/smash/record.jsf?pid=diva2:1276378
Strongly interacting Weyl semimetals : Stability of the semimetallic phase and emergence of almost...
DiVA portal is a finding tool for research publications and student theses written at the following universities and research institutions.
of the
https://repository.duke.edu/dc/eaa/A0640
Hoyt's German Cologne / Emergence of Advertising in America: 1850-1920 / Duke Digital Repository
https://www.fws.gov/rivers/media/sauta-cave-gray-bat-emergence
Sauta Cave gray bat emergence | FWS.gov
cavegraybatemergencefws
https://repository.si.edu/items/a48164ea-7d3c-4202-b52d-abdb869d63c2
Biological evidence supports an early and complex emergence of the Isthmus of Panama
The linking of North and South America by the Isthmus of Panama had major impacts on global climate, oceanic and atmospheric currents, and biodiversity, yet...
https://www.nber.org/papers/w22253
Theory and Measurement: Emergence, Consolidation and Erosion of a Consensus | NBER
Founded in 1920, the NBER is a private, non-profit, non-partisan organization dedicated to conducting economic research and to disseminating research findings...
of atheorymeasurementemergenceconsolidation
https://eric.ed.gov/?id=ED550099
ERIC - ED550099 - Cognitive versus Learning Styles: Emergence of the Ideal Education Model (IEM),...
Societies have striven through centuries to develop educational systems that would foster the most idealistic educational outcomes among learners. A brief...
https://davidpperlmutter.blogspot.com/2021/12/time-sneak-emergence-by-edge-o-erin.html
DAVID P PERLMUTTER: Time Sneak: Emergence by Edge O. Erin
books films movies authors actors actresses book author writing writers writing community
david pperlmuttertimesneakemergence
https://pubchem.ncbi.nlm.nih.gov/bioassay/1108744
AID 1108744 - Post emergence herbicidal activity against three-leaf stage Echinochloa crus-galli...
BioAssay record AID 1108744 submitted by ChEMBL: Post emergence herbicidal activity against three-leaf stage Echinochloa crus-galli (barnyard grass) assessed...
https://mackinstitute.wharton.upenn.edu/2020/progress-and-setbacks-the-two-faces-of-technology-emergence/
Progress and Setbacks: The Two Faces of Technology Emergence - Mack Institute for Innovation...
Mar 8, 2023 - Emerging technologies are an important driver of economic growth. However, the process of their emergence may not only be characterized by technological...
https://simoneweil.library.ucalgary.ca/bibliography/the-god-who-lives-an-examination-of-the-emergence-of-life-and-the-doctrine-of-god/
The God Who Lives: An Examination of the Emergence of Life and the Doctrine of God - Simone Weil...
https://gpbib.cs.ucl.ac.uk/gp-html/Channon_masters.html
The Evolutionary Emergence route to Artificial Intelligence
evolutionaryemergencerouteartificialintelligence
https://store.hbr.org/product/deepseek-the-emergence-and-evolution-of-ai-technology/W45604?searchid=0&search_query=Austin+Kimson%3Fpage%3D11%3Fpage%3D18
DeepSeek: The Emergence and Evolution of AI Technology
Buy books, tools, case studies, and articles on leadership, strategy, innovation, and other business and management topics
emergence and evolutiondeepseekaitechnology
https://portal.fis.tum.de/en/publications/the-effects-of-stream-substratum-composition-on-the-emergence-of-/
The effects of stream substratum composition on the emergence of salmonid fry - Technical...
effectsstreamsubstratum
https://repository.duke.edu/dc/eaa?f%5Bproduct_ssim%5D%5B%5D=Ramon%27s+Brownie+Pills&per_page=50
Product: Ramon's Brownie Pills / Emergence of Advertising in America: 1850-1920 / Duke Digital...
Over 3,300 advertising items and publications dating from 1850 to 1920, illustrating the rise of consumer culture and the birth of a professionalized...
https://bibleaves.library.illinois.edu/catalog/CC_X09491
From Emergency Management to Managing Emergence: A Genealogy of Disaster Management in Jamaica -...
emergency management
https://repository.duke.edu/dc/eaa?f%5Bcompany_ssim%5D%5B%5D=F.+S.+Webster+Co.&per_page=50&sort=score+desc%2Cdate_sort_si+asc%2Ctitle_ssi+asc
Company: F. S. Webster Co. / Emergence of Advertising in America: 1850-1920 / Duke Digital...
Over 3,300 advertising items and publications dating from 1850 to 1920, illustrating the rise of consumer culture and the birth of a professionalized...
https://pmc.ncbi.nlm.nih.gov/articles/PMC11926081/
The emergence of moral alignment within human groups is facilitated by interbrain synchrony - PMC
Humans tend to align their behaviors and beliefs with their group peers. Establishing alignment between group members is crucial for group unity, yet the...
https://www.ifm.eng.cam.ac.uk/insights/national-innovation-policies/different-roles-of-technology-in-technological-emergence/
The Different Roles of Technology in Technological Emergence
The IfM produces a range of publications and online resources based on its work with industry.
differentrolestechnologytechnologicalemergence
https://refubium.fu-berlin.de/handle/fub188/39691?locale-attribute=de
Refubium - Vocabularies of Motive for Corporate Social Responsibility: The Emergence of the...
for corporatesocial responsibilityvocabulariesmotiveemergence
https://www.evolve-world.org/
Evolve World | A human hive of co-creative emergence
We are a growing community of inquiry and practice that seeks to catalyze a new consciousness and culture. A culture rooted in regenerativity and guided by the...
evolveworldhumanhiveco
https://pubmed.ncbi.nlm.nih.gov/34679985/
Emergence of Parafilaria bovicola in Austria
Veterinarians reported cases of cutaneous bleeding in cattle in Austria in the spring and summer of 2020. It was our goal to confirm the tentative diagnosis of...
emergenceaustria
https://about.uq.edu.au/experts/project/62628
Structurally informed vaccines and therapies to resist and counter JEV emergence | Project | UQ...
https://www.mckinsey.com/industries/healthcare/our-insights/eric-larsen-on-the-emergence-and-potential-of-ai-in-healthcare
Eric Larsen on the emergence and potential of AI in healthcare | McKinsey
Eric Larsen, president of TowerBrook Advisors, discusses where healthcare incumbents stand in the current AI-focused environment and their opportunity to...
ai in healthcareeric larsenon the
https://digitalcommons.unl.edu/agronomyfacpub/304/
"Quality Traits in Forage Sorghum Harvested at Early Head Emergence and" by Jeffrey F. Pedersen,...
Information about the extent of variation in quality traits among plants sampled at the same developmental stage but on different dates would be useful to...
https://abc.com/show/59e160ba-96cd-479f-b8f0-0f5f3a0c1299/news
Emergence | News & Blogs
Get the latest Emergence news and blogs from cast and crew, read the latest scoop, and more from ABC.com TV blogs
emergencenewsblogs
https://kth.diva-portal.org/smash/record.jsf?pid=diva2%3A1952962
Emergence of Two Inertial Subranges in Solar Wind Turbulence : Dependence on Heliospheric Distance...
https://pmc.ncbi.nlm.nih.gov/articles/PMC4847771/
Emergence of Swarming Behavior: Foraging Agents Evolve Collective Motion Based on Signaling - PMC
Swarming behavior is common in biology, from cell colonies to insect swarms and bird flocks. However, the conditions leading to the emergence of such behavior...
https://www.frontiersin.org/journals/veterinary-science/articles/10.3389/fvets.2022.1111919/full
Frontiers | Emergence of human-porcine reassortment G9P[19] porcine rotavirus A strain in Guangdong...
Group A rotaviruses of the family Reoviridae is one of the important intestinal pathogens causing diarrhea in piglets and humans. A human-porcine reassortmen...
https://www.scirp.org/journal/paperinformation?paperid=70598
Evaluation of Biostimulants Added to Post Emergence Herbicides in Soybean
Discover the impact of biostimulants on soybean herbicides in Ontario. Explore 69 field experiments evaluating crop injury, weed control, and yield. Find out...
evaluationbiostimulantsaddedpostemergence
https://khmernz.blogspot.com/2010/10/analysis-re-emergence-of-old-power.html
.: Analysis: The re-emergence of an old power
via CAAI Tuesday, 05 October 2010 15:01 Catherine Oh Analysis --------------------------------------------------------------------------...
the reanalysisemergenceoldpower
https://repository.duke.edu/dc/eaa?f%5Bpublication_ssim%5D%5B%5D=New+York+Times
Publication: New York Times / Emergence of Advertising in America: 1850-1920 / Duke Digital...
Over 3,300 advertising items and publications dating from 1850 to 1920, illustrating the rise of consumer culture and the birth of a professionalized...
new york timesadvertising in america
https://scholars.cityu.edu.hk/en/publications/the-influence-of-enhanced-post-glacial-coastal-margin-productivit/
The Influence of Enhanced Post-Glacial Coastal Margin Productivity on the Emergence of Complex...
the influence
https://mau.diva-portal.org/smash/record.jsf?pid=diva2:1822730
Respectfully navigating the borderlands towards emergence
the borderlandsrespectfullynavigatingtowardsemergence
https://digitalcommons.usu.edu/wild_facpub/978/
"Comparison of Emergence Speed and Sterility in Two Steril Annual Hybri" by C. Morris and Eugene W....
By C. Morris and Eugene W. Schupp, Published on 01/01/07
https://cordis.europa.eu/project/id/890770/results/de
The Emergence of a Science of Vegetation in Early Modern Natural Philosophy and the Sciences of...
Deliverables, publications, datasets, software, exploitable results
https://philsci-archive.pitt.edu/29157/
Emergence and Autonomous Agency - PhilSci-Archive
emergenceautonomousagencyarchive
https://su.diva-portal.org/smash/record.jsf?pid=diva2:1536912
A First-principle Simulation of Blast-wave Emergence at the Photosphere of a Neutron Star Merger
https://macromusings.libsyn.com/12-will-luther-on-bitcoin-vodka-and-the-emergence-of-money
Macro Musings with David Beckworth: 12 - Will Luther on Bitcoin, Vodka, and the Emergence of Money
What is money and where does it come from? Will Luther, assistant professor of economics at Kenyon College, joins the show and explains the two competing...
https://esrp-emergence.com/
Accompagnement des Travailleurs Handicapés en Guadeloupe | ESRP Emergence
Sep 23, 2024 - Découvrez ESRP Emergence, un centre en Guadeloupe dédié à la réinsertion des travailleurs handicapés. Formations, accompagnement personnalisé, et orientation...
en guadeloupeaccompagnementdestravailleursesrp
https://ifp.nyu.edu/2023/journal-article-abstracts/hea0001273/
The emergence and persistence of the anti-vaccination movement. - information for practice
Aug 29, 2023 - Health Psychology, Vol 42(8), Aug 2023, 516-520; doi:10.1037/hea0001273Vaccine hesitancy is a significant threat to public health and the anti-vaccination
the emergenceinformation forpersistence
https://open.library.ubc.ca/soa/cIRcle/collections/ubctheses/831/items/1.0055466
One university, two universes : the emergence of Alaska native political leadership and the...
Learning, knowledge, research, insight: welcome to the world of UBC Library, the second-largest academic research library in Canada.
one universitythe emergence
https://repository.duke.edu/dc/eaa?f%5Bsubject_ssim%5D%5B%5D=Packaging%2C+Misc.
Subject: Packaging, Misc. / Emergence of Advertising in America: 1850-1920 / Duke Digital Repository
Over 3,300 advertising items and publications dating from 1850 to 1920, illustrating the rise of consumer culture and the birth of a professionalized...
advertising in america
https://psychedelicstoday.libsyn.com/kyle-and-joe-the-cost-of-spiritual-emergence-psychedelics-spirituality-and-capitalism
Psychedelics Today: Kyle and Joe - The Cost of Spiritual Emergence: Psychedelics, Spirituality and...
In this episode of Psychedelics Today, Kyle and Joe dig into and create conversation over an email received about the cost of psychedelics, the facets of...
the cost ofpsychedelics todayspiritual emergencekylejoe
https://events.marketsandmarkets.com/emergence-of-software-defined-vehicles/speaker-enquiry
Speaker Enquiry for Emergence Of Software-defined Vehicles - events@marketsandmarkets.com
Discover cutting-edge insights and industry trends at MarketsandMarkets Conferences. Explore our comprehensive lineup of conferences covering diverse sectors....
software defined vehiclesspeaker enquiryemergence
https://indico.ph.ed.ac.uk/event/115/contributions/1527/
Statistical mechanical theories of emergence in biological systems (Higgs Centre Workshop) (18-May...
https://environmentalhistory.yale.edu/public-events/veiled-voyagers-emergence-travel-writing-women-west-asia-council-middle-east-studies
Veiled Voyagers: The Emergence of Travel Writing by Women in West Asia (Council on Middle East...
https://gradlectures.berkeley.edu/lecture/life-and-of-intelligence/
The Emergence of Life and of Intelligence - Berkeley Graduate Lectures
the emergencelifeintelligenceberkeleygraduate
https://collaborate.princeton.edu/en/publications/impacts-of-biodiversity-on-the-emergence-and-transmission-of-infe/
Impacts of biodiversity on the emergence and transmission of infectious diseases - Princeton...
on theinfectious diseasesimpactsbiodiversity
https://repository.duke.edu/dc/eaa/D0244
50 Scenes of Perilous Occupations - Image 9 / Emergence of Advertising in America: 1850-1920 / Duke...
chamois hunting, knife-throwing (circus), surveyor, Indian Scout, fireman, picket, horse training
https://eprints.soton.ac.uk/452009/
Migrants on exhibition: The emergence of migrant worker museums in China as a neoliberal experiment...
https://meetings.aps.org/Meeting/MAR19/Session/F50.1
APS -APS March Meeting 2019 - Event - Emergence of large-scale chirality in photonic crystals in...
aps march meeting
https://pmc.ncbi.nlm.nih.gov/articles/PMC10977473/
The Emergence of the Old Drug Captagon as a New Illicit Drug: A Narrative Review - PMC
First developed in the 1960s in Europe and approved briefly for use in the United States, fenethylline (sold as Captagon, one of its early trade names) is now...
https://cicadas.uconn.edu/emergence-failure/
Emergence Failure | Periodical Cicada Information Pages | Biodiversity Research Collections |...
Feb 16, 2017 - Molting, or ecdysis, is a dangerous time for any insect. Before molting, in insect must find a secure perch where it will remain until is completes the proc ...
periodical cicadainformation pagesbiodiversity researchemergencefailure
https://journals.plos.org/ploscompbiol/article/comments?id=10.1371/journal.pcbi.1005631
Grandmothering and cognitive resources are required for the emergence of menopause and extensive...
Author summary In all human populations, regardless of environmental and socioeconomic conditions, menopause occurs in women well before the end of their...
https://www.geisteswissenschaften.fu-berlin.de/fachbereich/chronik/2011/forschung/vortraege/2011_05_26_dhcl_dirks.html
Nicholas B. Dirks: "Scholars and Spies: The Emergence of Area Studies in the United States and the...
https://researchportalplus.anu.edu.au/en/publications/social-identity-salience-and-the-emergence-of-stereotype-consensu/
Social identity salience and the emergence of stereotype consensus - The Australian National...
social identityand thesalience
https://repository.duke.edu/dc/eaa?f%5Bpublication_ssim%5D%5B%5D=Good+Housekeeping
Publication: Good Housekeeping / Emergence of Advertising in America: 1850-1920 / Duke Digital...
Over 3,300 advertising items and publications dating from 1850 to 1920, illustrating the rise of consumer culture and the birth of a professionalized...
advertising in americagood housekeeping
https://emergenceinsurance.com/us/
Emergence Insurance US: Smarter Cyber Insurance Home
May 17, 2026 - Emergence is exclusively focused on providing flexible, innovative and smarter insurance solutions to help protect against cyber risks.
emergenceinsuranceussmartercyber
https://pubmed.ncbi.nlm.nih.gov/25450514/
Variegated clonality and rapid emergence of new molecular lesions in xenografts of acute...
The use of genome-wide copy-number analysis and massive parallel sequencing has revolutionized the understanding of the clonal architecture of pediatric acute...
https://scholarworks.iu.edu/dspace/items/b2d71181-b3f2-493e-abb1-c27057ca92f7
The emergence of "particle resonance": concepts formation and the materiality of theory
the emergenceparticleresonanceconceptsformation
https://photocontest.smithsonianmag.com/photocontest/detail/emergence-7/
Emergence | Smithsonian Photo Contest | Smithsonian Magazine
This is a dragonfly emerging from its nymph state. The nymph lives in water during the larval stage for 2-5 years. Once fully grown they crawl out of the water...
photo contestemergencesmithsonianmagazine
https://12monkeysca.blogspot.com/2015/12/emergence-of-online-marketing-and-its-5.html
12Monkeys: Emergence of Online Marketing and Its 5 Best Benefits
Emergence of Online Marketing and Its 5 Best Benefits Convenience The first benefit offered by online marketing is the amazing c...
online marketingemergencebestbenefits
https://understandingsociety.blogspot.com/2014/03/kaidesoja-on-emergence.html
Understanding Society: Kaidesoja on emergence
understanding societyemergence
https://www.sciencedaily.com/releases/2016/04/160404090554.htm
Potential pathway for emergence of zoonotic malaria identified | ScienceDaily
The parasite responsible for a form of malaria now spreading from macaques to humans in South Asia could evolve to infect humans more efficiently, a step...
potentialpathwayemergencemalariaidentified
https://pubs.rsc.org/en/content/articlelanding/2017/cs/c7cs00123a
Exploring the emergence of complexity using synthetic replicators - Chemical Society Reviews (RSC...
A significant number of synthetic systems capable of replicating themselves or entities that are complementary to themselves have appeared in the last 30...
exploring the
https://digitalcommons.usf.edu/etd/1987/
"Studying the Effects of Motivation on the Emergence of Untrained Verba" by Alysia Gilliam
In Skinner's (1957) analysis of verbal behavior, the tact and mand are suggested to be functionally independent verbal operants. Many studies evaluating the...
https://www.ey.com/en_sy/newsroom/2023/11/the-emergence-of-genai-is-reshaping-the-2024-telecoms-risk-radar
The emergence of GenAI is reshaping the 2024 telecoms risk radar | EY - MENA
LONDON, 30 NOVEMBER 2023. Changing imperatives in privacy, security and trust emerges as the top risk facing telecoms companies in 2024.
the emergence
https://www.latimes.com/archives/la-xpm-1996-09-01-mn-39856-story.html
A Harmonic Emergence That Still Resonates - Los Angeles Times
Sep 1, 1996 - Culture: Changes in the local artistic community, social circles and the county at large underscore the venue's success--and its powerful influence.
los angelesharmonicemergencestillresonates
https://pubchem.ncbi.nlm.nih.gov/bioassay/1089516
AID 1089516 - Herbicidal activity against Lolium rigidum accession A01 assessed as emergence rate...
BioAssay record AID 1089516 submitted by ChEMBL: Herbicidal activity against Lolium rigidum accession A01 assessed as emergence rate applied at recommended...
https://kth.diva-portal.org/smash/record.jsf?faces-redirect=true&language=en&searchType=SIMPLE&query=&af=%5B%5D&aq=%5B%5B%5D%5D&aq2=%5B%5B%5D%5D&aqe=%5B%5D&pid=diva2%3A2018747&noOfRows=50&sortOrder=author_sort_asc&sortOrder2=title_sort_asc&onlyFullText=false&sf=all
Knowledge ecosystem emergence: Organizing participation, identity, and actorhood to bridge the...
knowledge ecosystememergenceorganizingparticipation
https://theses.gla.ac.uk/75417/
The Emergence of Philosophical Inquiry in 18th Century Scotland - Enlighten Theses
the emergencephilosophical inquiry
https://dl.tufts.edu/concern/videos/gt54m1439?timestamp/15:36
Video | Seema Alavi, Mughal Decline and the emergence of new global connections in early modern...
https://repository.duke.edu/dc/eaa/M0078
9th and Chestnut [Street] / Emergence of Advertising in America: 1850-1920 / Duke Digital Repository
behind a statue of Benjamin Franklin.
https://repository.duke.edu/dc/eaa?f%5Bproduct_ssim%5D%5B%5D=Pabst+Malt+Extract
Product: Pabst Malt Extract / Emergence of Advertising in America: 1850-1920 / Duke Digital...
Over 3,300 advertising items and publications dating from 1850 to 1920, illustrating the rise of consumer culture and the birth of a professionalized...
advertising in america
https://journals.publishing.umich.edu/circus/article/id/3922/
Stuckey | Emergence Editorial Introduction | Circus: Arts, Life, and Sciences
editorial introductioncircus artsstuckeyemergencelife
https://cordis.europa.eu/programme/id/FP7_Fission-2013-2.4.1
Support to the emergence of a possible European Research Initiative on co-generation | Programme |...
https://pmc.ncbi.nlm.nih.gov/articles/PMC2895282/
Emergence of Klebsiella pneumoniae carrying blaVIM and blaKPC genes - PMC
A Klebsiella pneumoniae clinical isolate resistant to imipenem was recovered from a wound sample. The patient, a 57-year-old man, underwent a surgical...
klebsiella pneumoniaeemergencecarryinggenespmc