Robuta

https://launchpad.net/~ondrej/+archive/ubuntu/php/ PPA for PHP : Ondřej Surý Co-installable PHP versions: PHP 5.6, PHP 7.x, PHP 8.x and most requested extensions are included. Packages are provided for *Current* Ubuntu *LTS* releases... for phpppa https://www.phpmyfaq.de/ phpMyFAQ - Open Source FAQ web application for PHP 8.2+ phpMyFAQ is a mobile-friendly, feature-rich, scalable open source FAQ web app for PHP 8.2+ open source faqweb applicationfor phpphpmyfaq https://commonmark.thephpleague.com/ CommonMark for PHP - Markdown done right PHP Markdown parser featuring support for CommonMark, GFM, and custom extensions for phpcommonmarkmarkdowndoneright https://github.com/swoole/swoole-src GitHub - swoole/swoole-src: 🚀 Coroutine-based concurrency library for PHP · GitHub 🚀 Coroutine-based concurrency library for PHP. Contribute to swoole/swoole-src development by creating an account on GitHub. for phpgithubswoolesrccoroutine https://roadmap.ploi.io/projects/1-server-level-requests/items/1483-add-apcu-support-for-php-extensions Add APCu support for PHP extensions - Ploi Roadmap Would it be possible to get the ability to manage APCu (install, enable) to the PHP extensions list on servers? Currently it only supports Imagick, Gm... support forphp extensionsaddapcuploi https://plettrealestate.com/Blog/The-Growing-Demand-for-PHP-Programmers-in-Canada.html The Growing Demand for PHP Programmers in Canada In recent years, the demand for php programmer canada has been steadily increasing. This is due to a combination of factors including the proliferation... growing demandfor phpprogrammerscanada https://talentoindia.com/jobs-category/php-developer?page=2 Jobs for PHP Developer Explore the latest job opportunities for PHP Developer roles on Talentoindia. Apply today and grow your career. for phpjobsdeveloper https://imrannazar.com/hacks/notpdo NotPDO for PHP: Wrapping MySQL to look like PDO - Imran Nazar It doesn't happen very often, but it does happen: you're deploying a PDO-based PHP application to a shared host, and they don't run PDO. If you can't... notpdo for phplook likewrappingmysql https://lornajane.net/posts/2011/installing-gearman-for-php-and-ubuntu Installing Gearman for PHP and Ubuntu | LornaJane for phpinstallinggearmanubuntulornajane https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-ec2-2016-11-15.html Api-Ec2-2016-11-15 - AWS SDK for PHP V3 aws sdk for phpapi https://php-jobs.net/job-tags/seo SEO for PHP Developers: Find Technical SEO Jobs Apply for PHP developer jobs with a strong SEO focus. Implement technical SEO best practices, optimize site performance, and build search-friendly seo forphp developersfindtechnicaljobs https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-kinesis-2013-12-02.html Api-Kinesis-2013-12-02 - AWS SDK for PHP V3 Api-Kinesis-2013-12-02 aws sdk for phpapikinesis https://www.gizguide.com/2018/06/jbl-go-2-portable-speaker-ph-price.html JBL GO 2 portable speaker now available for PHP 2,299! The second edition JBL GO portable speakers is now available in the Philippines for PHP 2,299. portable speakernow availablefor phpjblgo https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-cognito-idp-2016-04-18.html Api-Cognito-Idp-2016-04-18 - AWS SDK for PHP V3 Api-Cognito-Idp-2016-04-18 aws sdk for phpapicognitoidp https://example-code.com/phpAx/async.asp Async Examples for PHP ActiveX for phpasyncexamplesactivex https://atlphp.org/ Career Path Development For PHP Programming Professionals - Career Path Development For PHP... Career Path Development For PHP Programming Professionals career pathfor phpdevelopmentprogrammingprofessionals https://www.example-code.com/phpAx/simpletexting.asp SimpleTexting Examples for PHP ActiveX for phpsimpletextingexamplesactivex https://www.plesk.com/extensions/tuxcare-php/ TuxCare Extended Lifecycle Support for PHP extension - Plesk May 8, 2026 - TuxCare Extended Lifecycle Support for PHP extension. Explore the ecosystem of Plesk lifecycle supportfor phptuxcareextendedextension https://docs.cloud.google.com/php/docs/reference/cloud-financialservices/latest Google Cloud Financial Services for PHP | PHP client libraries | Google Cloud Documentation google cloudfinancial servicesfor phpclient librariesdocumentation https://odsol.com/WordPress-hosting.htm WordPress hosting - WordPress web hosting - the best hosting provider for PHP, Cpanel, Frontpage... Providing WordPress hosting, WordPress web hosting, affordable WordPress hosting, cheap WordPress hosting, php hosting, cpanel hosting, multiple domain... wordpress hostingthe bestfor phpwebprovider https://www.acistampa.com/archive/2021 Archive for ?php echo e(2021); ? for phparchiveecho https://ziarulbaricada.ro/announcing-a-specification-for-php/ Announcing a specification for PHP | Ziarul Baricada | Eduard-Victor Gugui Oct 23, 2022 - The model is talking about booking her latest gig, modeling WordPress underwear in the brand latest Perfectly Fit campaign, which was shot by Lachian Bailey.... for phpannouncingspecificationeduardvictor https://auraphp.com/framework/1.x/de/ Aura for PHP : Willkommen zu Aura for phpaurawillkommenzu https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-codepipeline-2015-07-09.html Api-Codepipeline-2015-07-09 - AWS SDK for PHP V3 Api-Codepipeline-2015-07-09 aws sdk for phpapicodepipeline https://cygwin.com/cygwin/packages/summary/php-pdo_dblib.html Cygwin Package Summary for php-pdo_dblib for phpcygwinpackagesummarypdo https://docs.amazonaws.cn/en_us/sdk-for-php/v3/developer-guide/env-provider.html env provider in the SDK for PHP - Amazon SDK for PHP Learn how to use environment variables to securely store and access Amazon credentials in your application, preventing accidental exposure of sensitive... env providerin thefor phpsdkamazon https://www.08i8.com/ttyxwh/detail1492.html ZbarCode For PHP Win32 x64 (PHP识别二维码php_zbarcode.dll 扩展)... ZbarCode For PHP Win32 x64 (PHP识别二维码php_zbarcode.dll 扩展) (PHP5.5、PHP5.6、PHP7.0、PHP7.1),采用 Zbar 版本: 0.10支持 PHP 版本 (Thread Safe): 5.5.* x86 5.5.* x64 5.6.* x86... for phpdll https://reference.aspose.com/barcode/php/classAlternativeScheme/ AlternativeScheme Class Reference - Aspose.BarCode for PHP via Java - API Reference class referencefor phpasposebarcodevia https://speakerdeck.com/player/08dbe1fd8b4b48a994f88aed000bf491 Cool Tools for PHP Development (Nashville PHP June 2021) - Speaker Deck cool toolsfor phpdevelopmentnashvillejune https://www.synology.com/en-uk/releaseNote/PHP7.2 Release Notes for PHP 7.2 | Synology Inc. Release Notes for PHP 7.2 | Synology Inc. release notesfor phpsynologyinc https://smart-fusion.ru/news.php?readmore=19 Smart System for PHP-Fusion - News: Smart System 4 is under development The official development and support site of Smart System, a universal infusion for content management system PHP-Fusion. Smart System is a free easy tool to... smart systemfor phpfusionnewsdevelopment https://qa.debian.org/excuses.php?experimental=1&package=php-pspell Experimental Pseudo-Excuses for php-pspell -- Debian Quality Assurance for phpexperimentalpseudoexcusespspell https://phansible.com/ Phansible - Create Vagrant + Ansible provisionings for PHP-based web servers Phansible provides an easy to use interface that helps you generate Ansible Playbooks for PHP based projects. for phpcreatevagrantansiblebased https://secure.odsol.com/phpAdsNew-hosting.htm PhpAdsNew hosting - phpAdsNew web hosting - the best hosting provider for PHP, Cpanel, Frontpage... Providing phpAdsNew hosting, phpAdsNew web hosting, affordable phpAdsNew hosting, cheap phpAdsNew hosting, php hosting, cpanel hosting, multiple domain... hosting webthe bestfor phpprovidercpanel https://www.jetbrains.com/help/phpstorm/2021.1/preparing-to-develop-a-google-app-for-php-application.html Develop a Google App for PHP application | PhpStorm google appfor phpdevelopapplicationphpstorm https://topic.alibabacloud.com/a/delphi-for-php-comprehensive-analysis_1_34_10101128.html Delphi for PHP Comprehensive analysis Delphi for the trial version of PHP, you need to pay attention to the official authorization of the trial time, only one day, I have been in business for the... for phpdelphicomprehensiveanalysis https://pubikom.net/hp-panduan-install-mikhmon-os7-via-server-for-php/ ( HP ) Panduan Install Mikhmon OS7 Via Server For PHP - PubiKOM for phppanduaninstallviaserver https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-iot-2015-05-28.html Api-Iot-2015-05-28 - AWS SDK for PHP V3 aws sdk for phpapiiot https://versary.town/blog/algebraic-effects-for-php/ algebraic effects for PHP - annieversary effect-system-php is a library that implements algebraic effects in PHP for phpalgebraiceffects https://technoworkshop.in/ Techno Workshop - Technical solutions for PHP, MySQL, PostgreSQL, Bootstrap, JQuery, GIS,... Apr 27, 2023 - Techno Workshop provides technical solutions about different technologies like PHP, MySQL, PostgreSQL, Bootstrap Front-end Framework, JQuery, GIS,... technical solutionsfor phptechnoworkshop https://aws.amazon.com/cn/about-aws/whats-new/2018/08/aws-elastic-beanstalk-adds-support-for-php-7-2/ AWS Elastic Beanstalk adds support for PHP 7.2 - AWS Discover more about what's new at AWS with AWS Elastic Beanstalk adds support for PHP 7.2 aws elastic beanstalksupport foraddsphp https://evertpot.com/go-for-php-programmers/ Go for PHP programmers go forphpprogrammers https://joshpress.net/blog/ubuntu-phpjs Scripts To Setup Ubuntu For PHP and JavaScript Development | Josh Pollock Bash scripts for configuring Ubuntu for PHP and JavaScript development. for phpjavascript developmentscriptssetupubuntu https://www.linode.com/community/questions/182/setting-up-logrotate-for-php-error-log Setting up logrotate for php error log (182) | Linode Questions Hi, I'm using a LAMP stack with Ubuntu 16.04 and fastcgi/php7.0-fpm. I have logrotate set up across all my logs apart from one php error log... setting upfor phperror loglogrotatelinode https://www.myamcat.com/jobs/description/php-developer-in-softgen-technologies-pvt-ltd-in-lucknow/2456 Apply for PHP Developer at Softgen Technologies Pvt. Ltd. in Lucknow Read more about and apply for PHP Developer at Softgen Technologies Pvt. Ltd. in Lucknow | Eligibility: B.Tech/B.E., MCA, MCM, P.G.D.C.A | AMCAT | 2456 apply forphp developer https://nocodewebscraping.com/top-10-web-scraping-books/web-scraping-for-php-developers/ Web scraping for PHP developers by - Simplified Web Scraping web scrapingfor phpdeveloperssimplified https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-appstream-2016-12-01.html Api-Appstream-2016-12-01 - AWS SDK for PHP V3 Api-Appstream-2016-12-01 aws sdk for phpapiappstream https://www.synology.com/hu-hu/releaseNote/PHP8.1 Release Notes for PHP 8.1 | Synology Inc. Release Notes for PHP 8.1 | Synology Inc. release notesfor phpsynologyinc https://www.flyenv.com/ FlyEnv - Native Local Development Environment for PHP, Node.js & AI FlyEnv is a native local development environment for PHP, Node.js, Python, databases, HTTPS, and local AI. Run projects on macOS, Windows, and Linux without... local developmentfor phpnode jsflyenvnative https://reference.aspose.com/cells/php/aspose.cells/Format3D Format3D - Aspose.Cells for PHP via Java - API Reference for phpjava apiasposecellsvia https://cloudsmith.com/product/formats/composer-repository Private, secure Composer repository for PHP teams | Cloudsmith Host and control your PHP Composer packages in Cloudsmith. Private repositories, vulnerability scanning, upstream proxying, and granular access controls - all... for phpprivatesecurecomposerrepository https://www.xml-sitemaps.com/forum/index.php/topic,2534.html map for php built site - Sitemap Generator Forum map for php built site for phpsite sitemapbuiltgeneratorforum https://mcqoptions.com/subject/php-questions-answers-exception-handling-6755 1+ Topic-wise solved MCQs for PHP Questions & Answers Exception Handling topic wisefor phpquestions answerssolvedmcqs https://www.exakat.io/prepare-for-php-7-error-messages-part-3/ Prepare for PHP 7 error messages (part 3) - Exakat May 26, 2015 - We can prepare for PHP 7 by reading the 8 of the new PHP 7 error messages that are waiting for us, and 3 that were dropped. prepare forerror messagesphppart https://www.compassnetworks.com.au/catalogsearch/result/?q=php%27%27123 Search results for: 'php''123' Compass Networks Online-Shop for all BlueOnyx related needs: Software, software updates, modules, services and support. search resultsfor php https://jobsuraksha.in/category/recruitment-services Hiring for PHP Web Developer | Job Suraksha Job Suraksha offers a way to completely optimize your entire recruiting process. ... What other people thought about the service provided by Jobsuraksha. php web developerhiring forjobsuraksha https://www.acistampa.com/archive/2025 Archive for ?php echo e(2025); ? for phparchiveecho https://www.hotscripts.com/category/scripts/php/scripts-programs/classified-ads/autos/page/2/ Page 2 results for PHP Classified Ad Scripts for Automobile and Vehicles Ad Listings for phpclassified ad https://reference.aspose.com/barcode/php/classMaxiCodeExtCodetextBuilder/ MaxiCodeExtCodetextBuilder Class Reference - Aspose.BarCode for PHP via Java - API Reference class referencefor phpasposebarcodevia https://docs.aws.amazon.com/aws-sdk-php/v3/api/namespace-Aws.cloudformation.html Namespace-Aws-Cloudformation - AWS SDK for PHP V3 Namespace-Aws-Cloudformation aws cloudformationnamespacesdkphp https://releases.aspose.com/id/slides/php-java/new-releases/aspose.slides-for-php-via-java-23.10/ Unduhan --- rilis baru-aspose.slides-for-php-via-java-23.10 for phpunduhanrilisbaruaspose https://evertpot.com/sabre-event/ sabre-event, a simple event management library for PHP 5.4 for phpsabreeventsimplemanagement https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-fsx-2018-03-01.html Api-Fsx-2018-03-01 - AWS SDK for PHP V3 aws sdk for phpapifsx https://jqmagick.imagemagick.org/discourse-server/viewforum.php?f=10&sid=397c9d8295aa10b2f5c954db866bb627 MagickWand for PHP - Legacy ImageMagick Discussions Archive for phpmagickwandlegacyimagemagickdiscussions https://auraphp.com/framework/1.x/en/routing/ Aura for PHP : Routing for phpaurarouting https://externals.io/message/128226 [RFC] [VOTE] Deprecations for PHP 8.5 - Externals for phprfcvotedeprecationsexternals https://servebolt.com/platforms/ Fast Hosting for PHP-Based Applications and Platforms Mar 10, 2026 - High-performance hosting built for your PHP and MySQL applications, supporting WordPress, WooCommerce, Drupal, Laravel, Magento 2, and more. fast hostingfor phpbasedapplicationsplatforms https://www.bdtask.com/blog/best-code-editors-and-ides-for-php-development 15 Best Code Editors and IDEs for PHP Development of 2024 Are you looking for PHP editing tools? Take a look at the best code Editors and IDEs for PHP development and find the suitable one for you. best code editorsfor php https://www.gyanbyte.com/php/46-how-install-mongo-db-driver-php-7x/ How to install Mongo DB Driver for Php 7.x | GyanByte How to install the MongoDB driver for PHP 7.x using PECL when the legacy mongo extension fails. how to installmongo dbfor php https://www.destinyhrgroup.com/job/jobs-for-php-developer-in-delhi-mehrauli Jobs for PHP Developer in Delhi Mehrauli | PHP Developer Destiny Team have best Jobs for PHP Developer and PHP Developer Jobs in Delhi Mehrauli with IT Company, Career@destinyhrgroup.com for phpjobsdeveloperdelhimehrauli https://www.elevatesoft.com/products?category=edb&type=php ElevateDB for PHP Database Developers for phpdatabasedevelopers https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-securityhub-2018-10-26.html Api-Securityhub-2018-10-26 - AWS SDK for PHP V3 Api-Securityhub-2018-10-26 aws sdk for phpapi https://www.odsol.com/LucidCMS-hosting.htm LucidCMS hosting - LucidCMS web hosting - the best hosting provider for PHP, Cpanel, Frontpage and... Providing LucidCMS hosting, LucidCMS web hosting, affordable LucidCMS hosting, cheap LucidCMS hosting, php hosting, cpanel hosting, multiple domain hosting,... hosting webthe bestfor php https://www.adityaplacementservices.in/job-openings-for-php-developer-kolhapur-1280936.htm Job openings for Php Developer in Kolhapur | Aditya Placement Services Apply for Web Developer Jobs in Kolhapur India - Web Developer Vacancy in IT Software - Ecommerce / Internet Technologies field with 0 to 1 years Work... job openingsfor phpdeveloperkolhapuraditya https://www.exeoutput.com/ ExeOutput for PHP - PHP to EXE Compiler for Windows Apps Nov 19, 2025 - Turn your PHP websites and scripts into standalone Windows applications with ExeOutput for PHP. Create desktop and console apps easily and securely to sell. exeoutput for phpcompilerwindowsapps https://packagist.org/packages/struggle-for-php/sfp-stubs-psr-log struggle-for-php/sfp-stubs-psr-log - Packagist.org Stubs to let Static Analysis understand psr/log (PSR-3) for phpstrugglesfpstubspsr https://www.acistampa.com/archive/2016 Archive for ?php echo e(2016); ? for phparchiveecho https://www.macphpstudy.com/ FlyEnv - Native Local Development Environment for PHP, Node.js & AI FlyEnv is a native local development environment for PHP, Node.js, Python, databases, HTTPS, and local AI. Run projects on macOS, Windows, and Linux without... local developmentfor phpnode jsflyenvnative https://qa.debian.org/excuses.php?package=php-horde-idna Testing Excuses for php-horde-idna -- Debian Quality Assurance for phptestingexcuseshordeidna https://www.udsm.ac.tz/announcement/scholarship-opportunity-php-studies-food-security-programme-readvertised Scholarship Opportunity for PhP Studies in Food Security Programme (Readvertised) | University of... scholarship opportunityfor phpin food https://www.amp-cloud.de/amp-plugins/php/eklentisi-amp-php.php?hl=en AMP Plugin for PHP - Download & Instructions - EN Activate AMP on PHP websites for fast loading times on mobile devices - Activate Accelerated Mobile Pages with just a few clicks and the AMP PHP script... amp pluginfor phpdownload instructionsen https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-ivs-realtime-2020-07-14.html Api-Ivs-Realtime-2020-07-14 - AWS SDK for PHP V3 Api-Ivs-Realtime-2020-07-14 aws sdk for phpapiivsrealtime https://www.synology.com/en-my/releaseNote/PHP8.1 Release Notes for PHP 8.1 | Synology Inc. Release Notes for PHP 8.1 | Synology Inc. release notesfor phpsynologyinc https://reference.aspose.com/cells/php/aspose.cells/ErrorBar ErrorBar - Aspose.Cells for PHP via Java - API Reference for phpjava apiasposecellsvia https://www.techieupgrader.in/2017/06/bitcoin-coinbase-api-for-php-example.html Bitcoin Coinbase API for PHP - Example - TechieUpgrader Programming Blog - Tutorials about Angular,... Tutorials focused on Web Development, ReactJS, Angular, JavaScript, PHP, Database Design, Ionic, Jquery and MySQL Techieupgrader programming blog for php https://odsol.com/PhpWiki-hosting.htm PhpWiki hosting - PhpWiki web hosting - the best hosting provider for PHP, Cpanel, Frontpage and... Providing PhpWiki hosting, PhpWiki web hosting, affordable PhpWiki hosting, cheap PhpWiki hosting, php hosting, cpanel hosting, multiple domain hosting, mysql... hosting webthe bestfor php https://launchdarkly.com/docs/sdk/openfeature/php OpenFeature provider for PHP SDK | LaunchDarkly | Documentation This topic documents how to get started with the LaunchDarkly OpenFeature provider for the PHP SDK. for phpopenfeatureprovidersdklaunchdarkly https://accreditly.io/articles/creating-your-own-formatter-in-faker-for-php-fakerphp Creating your own Formatter in Faker for PHP (FakerPHP) - Accreditly Create your own Formatter in FakerPHP in this tutorial that extends the popular PHP package: FakerPHP/Faker your ownfor phpcreatingformatterfaker https://www.odsol.com/Arizona-hosting.htm Arizona hosting - Arizona web hosting - the best hosting provider for PHP, Cpanel, Frontpage and... Providing Arizona hosting, Arizona web hosting, affordable Arizona hosting, cheap Arizona hosting, php hosting, cpanel hosting, multiple domain hosting, mysql... hosting webthe bestfor phparizona https://beamtic.com/problems-aws-sdk-php Beginner Problems Using the AWS SDK for PHP | Beamtic This Article covers some of the common problems a beginner might run into when using the AWS SDK for the first time. aws sdk for phpbeginnerproblemsusing https://onlyonekenobi.com/devops-for-php-developers-and-everyone-else/ DevOps for PHP developers, and everyone else | Kenobi's WordPress Corner for phpeveryone elsedevopsdevelopers https://ckeditor.com/old/forums/FCKeditor-2.x/Another-custom-filemanager-for-PHP Another custom filemanager for PHP | CKEditor.com Forums Custom filemanager for FCKeditor 2.0rc2Added delete file and image resizer (PHP only)Uses a image resize class by Ash Young (ash@evoluted.net) -... for phpanothercustomfilemanagerckeditor https://www.capitalplacement.in/job-openings-for-php-developer-delhi-gurgaon-1171926.htm Job openings for Php Developer in Delhi Gurgaon | Capital Placement Services Apply for PHP Developer For MNC Company in sector-48 Gurgaon Jobs in Delhi, Gurgaon India - PHP Developer For MNC Company in sector-48 Gurgaon Vacancy in IT... job openingsfor phpcapital placementdeveloper https://symfony.com/ Symfony, High Performance PHP Framework for Web Development Symfony is a web framework and a set of reusable PHP packages to build web applications, APIs, microservices and CLI apps. high performancephp frameworksymfonywebdevelopment https://xdebug.org/ Xdebug - Debugger and Profiler Tool for PHP Xdebug: A powerful debugger for PHP xdebugdebuggerprofilertoolphp https://rubixml.com/ Rubix - Machine Learning for PHP A suite of tools for end-to-end machine learning and deep learning using the PHP language. Start building programs that learn from your data with over 40... machine learningrubixphp https://github.com/chevere/chevere GitHub - chevere/chevere: High quality library for building PHP software · GitHub High quality library for building PHP software. Contribute to chevere/chevere development by creating an account on GitHub. high qualitybuilding phpgithubcheverelibrary https://www.phparch.com/ PHP Architect | The site for PHP professionals, Magazine, Training, Books, Conferences The site for PHP professionals, Magazine, Training, Books, Conferences php architectthe sitefor professionalstraining booksmagazine https://pyrocms.com/ PyroCMS › The PHP CMS built for Laravel. built forpyrocmsphplaravel