https://launchpad.net/~ondrej/+archive/ubuntu/php/
PPA for PHP : Ondřej Surý
Co-installable PHP versions: PHP 5.6, PHP 7.x, PHP 8.x and most requested extensions are included. Packages are provided for *Current* Ubuntu *LTS* releases...
for phpppa
https://www.phpmyfaq.de/
phpMyFAQ - Open Source FAQ web application for PHP 8.2+
phpMyFAQ is a mobile-friendly, feature-rich, scalable open source FAQ web app for PHP 8.2+
open source faqweb applicationfor phpphpmyfaq
https://commonmark.thephpleague.com/
CommonMark for PHP - Markdown done right
PHP Markdown parser featuring support for CommonMark, GFM, and custom extensions
for phpcommonmarkmarkdowndoneright
https://github.com/swoole/swoole-src
GitHub - swoole/swoole-src: 🚀 Coroutine-based concurrency library for PHP · GitHub
🚀 Coroutine-based concurrency library for PHP. Contribute to swoole/swoole-src development by creating an account on GitHub.
for phpgithubswoolesrccoroutine
https://roadmap.ploi.io/projects/1-server-level-requests/items/1483-add-apcu-support-for-php-extensions
Add APCu support for PHP extensions - Ploi Roadmap
Would it be possible to get the ability to manage APCu (install, enable) to the PHP extensions list on servers? Currently it only supports Imagick, Gm...
support forphp extensionsaddapcuploi
https://plettrealestate.com/Blog/The-Growing-Demand-for-PHP-Programmers-in-Canada.html
The Growing Demand for PHP Programmers in Canada
In recent years, the demand for php programmer canada has been steadily increasing. This is due to a combination of factors including the proliferation...
growing demandfor phpprogrammerscanada
https://talentoindia.com/jobs-category/php-developer?page=2
Jobs for PHP Developer
Explore the latest job opportunities for PHP Developer roles on Talentoindia. Apply today and grow your career.
for phpjobsdeveloper
https://imrannazar.com/hacks/notpdo
NotPDO for PHP: Wrapping MySQL to look like PDO - Imran Nazar
It doesn't happen very often, but it does happen: you're deploying a PDO-based PHP application to a shared host, and they don't run PDO. If you can't...
notpdo for phplook likewrappingmysql
https://lornajane.net/posts/2011/installing-gearman-for-php-and-ubuntu
Installing Gearman for PHP and Ubuntu | LornaJane
for phpinstallinggearmanubuntulornajane
https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-ec2-2016-11-15.html
Api-Ec2-2016-11-15 - AWS SDK for PHP V3
aws sdk for phpapi
https://php-jobs.net/job-tags/seo
SEO for PHP Developers: Find Technical SEO Jobs
Apply for PHP developer jobs with a strong SEO focus. Implement technical SEO best practices, optimize site performance, and build search-friendly
seo forphp developersfindtechnicaljobs
https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-kinesis-2013-12-02.html
Api-Kinesis-2013-12-02 - AWS SDK for PHP V3
Api-Kinesis-2013-12-02
aws sdk for phpapikinesis
https://www.gizguide.com/2018/06/jbl-go-2-portable-speaker-ph-price.html
JBL GO 2 portable speaker now available for PHP 2,299!
The second edition JBL GO portable speakers is now available in the Philippines for PHP 2,299.
portable speakernow availablefor phpjblgo
https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-cognito-idp-2016-04-18.html
Api-Cognito-Idp-2016-04-18 - AWS SDK for PHP V3
Api-Cognito-Idp-2016-04-18
aws sdk for phpapicognitoidp
https://example-code.com/phpAx/async.asp
Async Examples for PHP ActiveX
for phpasyncexamplesactivex
https://atlphp.org/
Career Path Development For PHP Programming Professionals - Career Path Development For PHP...
Career Path Development For PHP Programming Professionals
career pathfor phpdevelopmentprogrammingprofessionals
https://www.example-code.com/phpAx/simpletexting.asp
SimpleTexting Examples for PHP ActiveX
for phpsimpletextingexamplesactivex
https://www.plesk.com/extensions/tuxcare-php/
TuxCare Extended Lifecycle Support for PHP extension - Plesk
May 8, 2026 - TuxCare Extended Lifecycle Support for PHP extension. Explore the ecosystem of Plesk
lifecycle supportfor phptuxcareextendedextension
https://docs.cloud.google.com/php/docs/reference/cloud-financialservices/latest
Google Cloud Financial Services for PHP | PHP client libraries | Google Cloud Documentation
google cloudfinancial servicesfor phpclient librariesdocumentation
https://odsol.com/WordPress-hosting.htm
WordPress hosting - WordPress web hosting - the best hosting provider for PHP, Cpanel, Frontpage...
Providing WordPress hosting, WordPress web hosting, affordable WordPress hosting, cheap WordPress hosting, php hosting, cpanel hosting, multiple domain...
wordpress hostingthe bestfor phpwebprovider
https://www.acistampa.com/archive/2021
Archive for ?php echo e(2021); ?
for phparchiveecho
https://ziarulbaricada.ro/announcing-a-specification-for-php/
Announcing a specification for PHP | Ziarul Baricada | Eduard-Victor Gugui
Oct 23, 2022 - The model is talking about booking her latest gig, modeling WordPress underwear in the brand latest Perfectly Fit campaign, which was shot by Lachian Bailey....
for phpannouncingspecificationeduardvictor
https://auraphp.com/framework/1.x/de/
Aura for PHP : Willkommen zu Aura
for phpaurawillkommenzu
https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-codepipeline-2015-07-09.html
Api-Codepipeline-2015-07-09 - AWS SDK for PHP V3
Api-Codepipeline-2015-07-09
aws sdk for phpapicodepipeline
https://cygwin.com/cygwin/packages/summary/php-pdo_dblib.html
Cygwin Package Summary for php-pdo_dblib
for phpcygwinpackagesummarypdo
https://docs.amazonaws.cn/en_us/sdk-for-php/v3/developer-guide/env-provider.html
env provider in the SDK for PHP - Amazon SDK for PHP
Learn how to use environment variables to securely store and access Amazon credentials in your application, preventing accidental exposure of sensitive...
env providerin thefor phpsdkamazon
https://www.08i8.com/ttyxwh/detail1492.html
ZbarCode For PHP Win32 x64 (PHP识别二维码php_zbarcode.dll 扩展)...
ZbarCode For PHP Win32 x64 (PHP识别二维码php_zbarcode.dll 扩展) (PHP5.5、PHP5.6、PHP7.0、PHP7.1),采用 Zbar 版本: 0.10支持 PHP 版本 (Thread Safe): 5.5.* x86 5.5.* x64 5.6.* x86...
for phpdll
https://reference.aspose.com/barcode/php/classAlternativeScheme/
AlternativeScheme Class Reference - Aspose.BarCode for PHP via Java - API Reference
class referencefor phpasposebarcodevia
https://speakerdeck.com/player/08dbe1fd8b4b48a994f88aed000bf491
Cool Tools for PHP Development (Nashville PHP June 2021) - Speaker Deck
cool toolsfor phpdevelopmentnashvillejune
https://www.synology.com/en-uk/releaseNote/PHP7.2
Release Notes for PHP 7.2 | Synology Inc.
Release Notes for PHP 7.2 | Synology Inc.
release notesfor phpsynologyinc
https://smart-fusion.ru/news.php?readmore=19
Smart System for PHP-Fusion - News: Smart System 4 is under development
The official development and support site of Smart System, a universal infusion for content management system PHP-Fusion. Smart System is a free easy tool to...
smart systemfor phpfusionnewsdevelopment
https://qa.debian.org/excuses.php?experimental=1&package=php-pspell
Experimental Pseudo-Excuses for php-pspell -- Debian Quality Assurance
for phpexperimentalpseudoexcusespspell
https://phansible.com/
Phansible - Create Vagrant + Ansible provisionings for PHP-based web servers
Phansible provides an easy to use interface that helps you generate Ansible Playbooks for PHP based projects.
for phpcreatevagrantansiblebased
https://secure.odsol.com/phpAdsNew-hosting.htm
PhpAdsNew hosting - phpAdsNew web hosting - the best hosting provider for PHP, Cpanel, Frontpage...
Providing phpAdsNew hosting, phpAdsNew web hosting, affordable phpAdsNew hosting, cheap phpAdsNew hosting, php hosting, cpanel hosting, multiple domain...
hosting webthe bestfor phpprovidercpanel
https://www.jetbrains.com/help/phpstorm/2021.1/preparing-to-develop-a-google-app-for-php-application.html
Develop a Google App for PHP application | PhpStorm
google appfor phpdevelopapplicationphpstorm
https://topic.alibabacloud.com/a/delphi-for-php-comprehensive-analysis_1_34_10101128.html
Delphi for PHP Comprehensive analysis
Delphi for the trial version of PHP, you need to pay attention to the official authorization of the trial time, only one day, I have been in business for the...
for phpdelphicomprehensiveanalysis
https://pubikom.net/hp-panduan-install-mikhmon-os7-via-server-for-php/
( HP ) Panduan Install Mikhmon OS7 Via Server For PHP - PubiKOM
for phppanduaninstallviaserver
https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-iot-2015-05-28.html
Api-Iot-2015-05-28 - AWS SDK for PHP V3
aws sdk for phpapiiot
https://versary.town/blog/algebraic-effects-for-php/
algebraic effects for PHP - annieversary
effect-system-php is a library that implements algebraic effects in PHP
for phpalgebraiceffects
https://technoworkshop.in/
Techno Workshop - Technical solutions for PHP, MySQL, PostgreSQL, Bootstrap, JQuery, GIS,...
Apr 27, 2023 - Techno Workshop provides technical solutions about different technologies like PHP, MySQL, PostgreSQL, Bootstrap Front-end Framework, JQuery, GIS,...
technical solutionsfor phptechnoworkshop
https://aws.amazon.com/cn/about-aws/whats-new/2018/08/aws-elastic-beanstalk-adds-support-for-php-7-2/
AWS Elastic Beanstalk adds support for PHP 7.2 - AWS
Discover more about what's new at AWS with AWS Elastic Beanstalk adds support for PHP 7.2
aws elastic beanstalksupport foraddsphp
https://evertpot.com/go-for-php-programmers/
Go for PHP programmers
go forphpprogrammers
https://joshpress.net/blog/ubuntu-phpjs
Scripts To Setup Ubuntu For PHP and JavaScript Development | Josh Pollock
Bash scripts for configuring Ubuntu for PHP and JavaScript development.
for phpjavascript developmentscriptssetupubuntu
https://www.linode.com/community/questions/182/setting-up-logrotate-for-php-error-log
Setting up logrotate for php error log (182) | Linode Questions
Hi, I'm using a LAMP stack with Ubuntu 16.04 and fastcgi/php7.0-fpm. I have logrotate set up across all my logs apart from one php error log...
setting upfor phperror loglogrotatelinode
https://www.myamcat.com/jobs/description/php-developer-in-softgen-technologies-pvt-ltd-in-lucknow/2456
Apply for PHP Developer at Softgen Technologies Pvt. Ltd. in Lucknow
Read more about and apply for PHP Developer at Softgen Technologies Pvt. Ltd. in Lucknow | Eligibility: B.Tech/B.E., MCA, MCM, P.G.D.C.A | AMCAT | 2456
apply forphp developer
https://nocodewebscraping.com/top-10-web-scraping-books/web-scraping-for-php-developers/
Web scraping for PHP developers by - Simplified Web Scraping
web scrapingfor phpdeveloperssimplified
https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-appstream-2016-12-01.html
Api-Appstream-2016-12-01 - AWS SDK for PHP V3
Api-Appstream-2016-12-01
aws sdk for phpapiappstream
https://www.synology.com/hu-hu/releaseNote/PHP8.1
Release Notes for PHP 8.1 | Synology Inc.
Release Notes for PHP 8.1 | Synology Inc.
release notesfor phpsynologyinc
https://www.flyenv.com/
FlyEnv - Native Local Development Environment for PHP, Node.js & AI
FlyEnv is a native local development environment for PHP, Node.js, Python, databases, HTTPS, and local AI. Run projects on macOS, Windows, and Linux without...
local developmentfor phpnode jsflyenvnative
https://reference.aspose.com/cells/php/aspose.cells/Format3D
Format3D - Aspose.Cells for PHP via Java - API Reference
for phpjava apiasposecellsvia
https://cloudsmith.com/product/formats/composer-repository
Private, secure Composer repository for PHP teams | Cloudsmith
Host and control your PHP Composer packages in Cloudsmith. Private repositories, vulnerability scanning, upstream proxying, and granular access controls - all...
for phpprivatesecurecomposerrepository
https://www.xml-sitemaps.com/forum/index.php/topic,2534.html
map for php built site - Sitemap Generator Forum
map for php built site
for phpsite sitemapbuiltgeneratorforum
https://mcqoptions.com/subject/php-questions-answers-exception-handling-6755
1+ Topic-wise solved MCQs for PHP Questions & Answers Exception Handling
topic wisefor phpquestions answerssolvedmcqs
https://www.exakat.io/prepare-for-php-7-error-messages-part-3/
Prepare for PHP 7 error messages (part 3) - Exakat
May 26, 2015 - We can prepare for PHP 7 by reading the 8 of the new PHP 7 error messages that are waiting for us, and 3 that were dropped.
prepare forerror messagesphppart
https://www.compassnetworks.com.au/catalogsearch/result/?q=php%27%27123
Search results for: 'php''123'
Compass Networks Online-Shop for all BlueOnyx related needs: Software, software updates, modules, services and support.
search resultsfor php
https://jobsuraksha.in/category/recruitment-services
Hiring for PHP Web Developer | Job Suraksha
Job Suraksha offers a way to completely optimize your entire recruiting process. ... What other people thought about the service provided by Jobsuraksha.
php web developerhiring forjobsuraksha
https://www.acistampa.com/archive/2025
Archive for ?php echo e(2025); ?
for phparchiveecho
https://www.hotscripts.com/category/scripts/php/scripts-programs/classified-ads/autos/page/2/
Page 2 results for PHP Classified Ad Scripts for Automobile and Vehicles Ad Listings
for phpclassified ad
https://reference.aspose.com/barcode/php/classMaxiCodeExtCodetextBuilder/
MaxiCodeExtCodetextBuilder Class Reference - Aspose.BarCode for PHP via Java - API Reference
class referencefor phpasposebarcodevia
https://docs.aws.amazon.com/aws-sdk-php/v3/api/namespace-Aws.cloudformation.html
Namespace-Aws-Cloudformation - AWS SDK for PHP V3
Namespace-Aws-Cloudformation
aws cloudformationnamespacesdkphp
https://releases.aspose.com/id/slides/php-java/new-releases/aspose.slides-for-php-via-java-23.10/
Unduhan --- rilis baru-aspose.slides-for-php-via-java-23.10
for phpunduhanrilisbaruaspose
https://evertpot.com/sabre-event/
sabre-event, a simple event management library for PHP 5.4
for phpsabreeventsimplemanagement
https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-fsx-2018-03-01.html
Api-Fsx-2018-03-01 - AWS SDK for PHP V3
aws sdk for phpapifsx
https://jqmagick.imagemagick.org/discourse-server/viewforum.php?f=10&sid=397c9d8295aa10b2f5c954db866bb627
MagickWand for PHP - Legacy ImageMagick Discussions Archive
for phpmagickwandlegacyimagemagickdiscussions
https://auraphp.com/framework/1.x/en/routing/
Aura for PHP : Routing
for phpaurarouting
https://externals.io/message/128226
[RFC] [VOTE] Deprecations for PHP 8.5 - Externals
for phprfcvotedeprecationsexternals
https://servebolt.com/platforms/
Fast Hosting for PHP-Based Applications and Platforms
Mar 10, 2026 - High-performance hosting built for your PHP and MySQL applications, supporting WordPress, WooCommerce, Drupal, Laravel, Magento 2, and more.
fast hostingfor phpbasedapplicationsplatforms
https://www.bdtask.com/blog/best-code-editors-and-ides-for-php-development
15 Best Code Editors and IDEs for PHP Development of 2024
Are you looking for PHP editing tools? Take a look at the best code Editors and IDEs for PHP development and find the suitable one for you.
best code editorsfor php
https://www.gyanbyte.com/php/46-how-install-mongo-db-driver-php-7x/
How to install Mongo DB Driver for Php 7.x | GyanByte
How to install the MongoDB driver for PHP 7.x using PECL when the legacy mongo extension fails.
how to installmongo dbfor php
https://www.destinyhrgroup.com/job/jobs-for-php-developer-in-delhi-mehrauli
Jobs for PHP Developer in Delhi Mehrauli | PHP Developer
Destiny Team have best Jobs for PHP Developer and PHP Developer Jobs in Delhi Mehrauli with IT Company, Career@destinyhrgroup.com
for phpjobsdeveloperdelhimehrauli
https://www.elevatesoft.com/products?category=edb&type=php
ElevateDB for PHP Database Developers
for phpdatabasedevelopers
https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-securityhub-2018-10-26.html
Api-Securityhub-2018-10-26 - AWS SDK for PHP V3
Api-Securityhub-2018-10-26
aws sdk for phpapi
https://www.odsol.com/LucidCMS-hosting.htm
LucidCMS hosting - LucidCMS web hosting - the best hosting provider for PHP, Cpanel, Frontpage and...
Providing LucidCMS hosting, LucidCMS web hosting, affordable LucidCMS hosting, cheap LucidCMS hosting, php hosting, cpanel hosting, multiple domain hosting,...
hosting webthe bestfor php
https://www.adityaplacementservices.in/job-openings-for-php-developer-kolhapur-1280936.htm
Job openings for Php Developer in Kolhapur | Aditya Placement Services
Apply for Web Developer Jobs in Kolhapur India - Web Developer Vacancy in IT Software - Ecommerce / Internet Technologies field with 0 to 1 years Work...
job openingsfor phpdeveloperkolhapuraditya
https://www.exeoutput.com/
ExeOutput for PHP - PHP to EXE Compiler for Windows Apps
Nov 19, 2025 - Turn your PHP websites and scripts into standalone Windows applications with ExeOutput for PHP. Create desktop and console apps easily and securely to sell.
exeoutput for phpcompilerwindowsapps
https://packagist.org/packages/struggle-for-php/sfp-stubs-psr-log
struggle-for-php/sfp-stubs-psr-log - Packagist.org
Stubs to let Static Analysis understand psr/log (PSR-3)
for phpstrugglesfpstubspsr
https://www.acistampa.com/archive/2016
Archive for ?php echo e(2016); ?
for phparchiveecho
https://www.macphpstudy.com/
FlyEnv - Native Local Development Environment for PHP, Node.js & AI
FlyEnv is a native local development environment for PHP, Node.js, Python, databases, HTTPS, and local AI. Run projects on macOS, Windows, and Linux without...
local developmentfor phpnode jsflyenvnative
https://qa.debian.org/excuses.php?package=php-horde-idna
Testing Excuses for php-horde-idna -- Debian Quality Assurance
for phptestingexcuseshordeidna
https://www.udsm.ac.tz/announcement/scholarship-opportunity-php-studies-food-security-programme-readvertised
Scholarship Opportunity for PhP Studies in Food Security Programme (Readvertised) | University of...
scholarship opportunityfor phpin food
https://www.amp-cloud.de/amp-plugins/php/eklentisi-amp-php.php?hl=en
AMP Plugin for PHP - Download & Instructions - EN
Activate AMP on PHP websites for fast loading times on mobile devices - Activate Accelerated Mobile Pages with just a few clicks and the AMP PHP script...
amp pluginfor phpdownload instructionsen
https://docs.aws.amazon.com/aws-sdk-php/v3/api/api-ivs-realtime-2020-07-14.html
Api-Ivs-Realtime-2020-07-14 - AWS SDK for PHP V3
Api-Ivs-Realtime-2020-07-14
aws sdk for phpapiivsrealtime
https://www.synology.com/en-my/releaseNote/PHP8.1
Release Notes for PHP 8.1 | Synology Inc.
Release Notes for PHP 8.1 | Synology Inc.
release notesfor phpsynologyinc
https://reference.aspose.com/cells/php/aspose.cells/ErrorBar
ErrorBar - Aspose.Cells for PHP via Java - API Reference
for phpjava apiasposecellsvia
https://www.techieupgrader.in/2017/06/bitcoin-coinbase-api-for-php-example.html
Bitcoin Coinbase API for PHP - Example - TechieUpgrader Programming Blog - Tutorials about Angular,...
Tutorials focused on Web Development, ReactJS, Angular, JavaScript, PHP, Database Design, Ionic, Jquery and MySQL Techieupgrader programming blog
for php
https://odsol.com/PhpWiki-hosting.htm
PhpWiki hosting - PhpWiki web hosting - the best hosting provider for PHP, Cpanel, Frontpage and...
Providing PhpWiki hosting, PhpWiki web hosting, affordable PhpWiki hosting, cheap PhpWiki hosting, php hosting, cpanel hosting, multiple domain hosting, mysql...
hosting webthe bestfor php
https://launchdarkly.com/docs/sdk/openfeature/php
OpenFeature provider for PHP SDK | LaunchDarkly | Documentation
This topic documents how to get started with the LaunchDarkly OpenFeature provider for the PHP SDK.
for phpopenfeatureprovidersdklaunchdarkly
https://accreditly.io/articles/creating-your-own-formatter-in-faker-for-php-fakerphp
Creating your own Formatter in Faker for PHP (FakerPHP) - Accreditly
Create your own Formatter in FakerPHP in this tutorial that extends the popular PHP package: FakerPHP/Faker
your ownfor phpcreatingformatterfaker
https://www.odsol.com/Arizona-hosting.htm
Arizona hosting - Arizona web hosting - the best hosting provider for PHP, Cpanel, Frontpage and...
Providing Arizona hosting, Arizona web hosting, affordable Arizona hosting, cheap Arizona hosting, php hosting, cpanel hosting, multiple domain hosting, mysql...
hosting webthe bestfor phparizona
https://beamtic.com/problems-aws-sdk-php
Beginner Problems Using the AWS SDK for PHP | Beamtic
This Article covers some of the common problems a beginner might run into when using the AWS SDK for the first time.
aws sdk for phpbeginnerproblemsusing
https://onlyonekenobi.com/devops-for-php-developers-and-everyone-else/
DevOps for PHP developers, and everyone else | Kenobi's WordPress Corner
for phpeveryone elsedevopsdevelopers
https://ckeditor.com/old/forums/FCKeditor-2.x/Another-custom-filemanager-for-PHP
Another custom filemanager for PHP | CKEditor.com Forums
Custom filemanager for FCKeditor 2.0rc2Added delete file and image resizer (PHP only)Uses a image resize class by Ash Young (ash@evoluted.net) -...
for phpanothercustomfilemanagerckeditor
https://www.capitalplacement.in/job-openings-for-php-developer-delhi-gurgaon-1171926.htm
Job openings for Php Developer in Delhi Gurgaon | Capital Placement Services
Apply for PHP Developer For MNC Company in sector-48 Gurgaon Jobs in Delhi, Gurgaon India - PHP Developer For MNC Company in sector-48 Gurgaon Vacancy in IT...
job openingsfor phpcapital placementdeveloper
https://symfony.com/
Symfony, High Performance PHP Framework for Web Development
Symfony is a web framework and a set of reusable PHP packages to build web applications, APIs, microservices and CLI apps.
high performancephp frameworksymfonywebdevelopment
https://xdebug.org/
Xdebug - Debugger and Profiler Tool for PHP
Xdebug: A powerful debugger for PHP
xdebugdebuggerprofilertoolphp
https://rubixml.com/
Rubix - Machine Learning for PHP
A suite of tools for end-to-end machine learning and deep learning using the PHP language. Start building programs that learn from your data with over 40...
machine learningrubixphp
https://github.com/chevere/chevere
GitHub - chevere/chevere: High quality library for building PHP software · GitHub
High quality library for building PHP software. Contribute to chevere/chevere development by creating an account on GitHub.
high qualitybuilding phpgithubcheverelibrary
https://www.phparch.com/
PHP Architect | The site for PHP professionals, Magazine, Training, Books, Conferences
The site for PHP professionals, Magazine, Training, Books, Conferences
php architectthe sitefor professionalstraining booksmagazine
https://pyrocms.com/
PyroCMS › The PHP CMS built for Laravel.
built forpyrocmsphplaravel