Robuta

https://gaotek.com/category/iot/rfid-ble/ble-gateways-beacons-accessories/ BLE Gateways, Beacons & Accessories - GAO Tek GAO’s BLE Gateways are devices that connect Bluetooth Low Energy (BLE) devices to the internet, enabling remote monitoring and control. They aggregate data... blegatewaysbeaconsaccessoriesgao https://cryptwerk.com/company/blockbee/ BlockBee - reviews, contacts & details | Payment gateways | Crypto services One platform, all payments infrastructure for crypto BlockBee, created by the experienced team behind CryptAPI, is aiming to build a powerful,... payment gatewayscrypto servicesblockbeereviewscontacts https://www.inforisktoday.com/hacked-devices-are-gateways-for-chinese-nation-state-hackers-a-31490 Hacked Devices Are Gateways for Chinese Nation-State Hackers Networks comprised of hacked domestic devices underpin a mounting number of Chinese nation-state hacking operations, warned British, U.S. and a slew of other hackeddevicesgatewayschinesenation https://www.tourmyindia.com/weekend-tours/weekend-getaways-chennai.html Weekend Tours From Chennai- Weekend Gateways Around Chennai weekendtourschennaigatewaysaround https://developer.woocommerce.com/2026/04/06/payment-gateways-have-always-been-enabled-a-debrief/ Payment gateways have always been enabled: A debrief Developer Advisories – The WooCommerce... Apr 6, 2026 - Read more about the Developer Advisory for WooCommerce PayPal Payments; regional gateways were always enabled, but you can disable them. payment gatewaysalwaysenableddeveloperadvisories https://www.hms-networks.com/products/building-automation/aw-heat-pump-gateways Air-to-Water Heat Pump Gateways for building control Air-to-Water Heat Pump gateways for seamless integration into BACnet, KNX, and Modbus. Enable smart and efficient control of climatization and DHW from your BMS heat pumpbuilding controlairwatergateways https://www.solo.io/resources/ebook/api-gateways-productivity-resilience-and-security-for-next-generation-cloud-applications API Gateways: Productivity, Resilience, and Security for Next-Generation Cloud Applications - Ebook... Apr 10, 2026 - The rise of microservices architecture has brought about a significant shift in how software is developed and deployed, and as such, has presented new... resilience and securityapi gatewaysnext generationcloud applicationsproductivity https://omr.com/de/reviews/category/secure-email-gateway Secure E-Mail Gateways im Vergleich | OMR Reviews Finde bei OMR Reviews die besten Secure E-Mail Gateway Lösungen – bewertet von verifizierten Nutzer*innen. Jetzt Anbieter vergleichen! omr reviewssecuremailgatewaysim https://www.ecwid.com/payments Online Payment Gateways for Ecommerce | Accept Payments Online Mar 10, 2025 - Give your online shoppers payment options that are both safe and convenient. Choose from 100+ Ecwid integrated payment gateways and start selling today. online paymentfor ecommerceaccept paymentsgateways https://kb.fanso.io/knowledgebase/what-are-the-payment-gateways-in-the-platform-fe-be-explanation/ What are the payment gateways in the platform? (FE & BE Explanation ) - Fanso Knowledge Base payment gatewaysknowledge baseplatformfeexplanation https://woocommerce.com/product-category/woocommerce-extensions/payment-gateways/online-payments/ Processors & gateways - WooCommerce processorsgatewayswoocommerce https://site.pro/Plugins/ Plugin List. E-commerce Payment Gateways - Site.pro Builder plugin and functions. Many functions and plugins depending on geographical preferences. Plugin description. plugin liste commercepayment gatewayssite pro https://syde.com/services/woocommerce-payment-gateways/ Payment Gateways for WooCommerce - Syde Jan 13, 2026 - Payment Gateways for WooCommerce Secure transactions and seamless experiences for you and your users Are you planning to bring your payment solution to one of... payment gatewayswoocommercesyde https://www.solo.io/academy Solo Academy | Free Cloud-Native Training in API Gateways, Istio, Agentic AI & More Upskill in modern cloud connectivity from networking and service mesh to API gateways and agentic AI. Free, hands-on labs and courses for you to learn at your... solo academycloud nativeapi gatewaysagentic aifree https://sabpaisa.in/ One of the Best Payment Gateways in India | SabPaisa Apr 24, 2026 - SabPaisa is an RBI-authorised payment gateway in India, offering payment links, e-NACH, payouts, offline payments, and more on one platform. one ofthe bestpayment gatewaysindia https://www.omadanetworks.com/us/business-networking/omada-router-wired-router/ Wired Gateways | TP-Link TP Link - Wired Gateways wired gatewaystp link https://slidge.im/ slidge.im — Gateways from XMPP to Other Networks Slidge is a chat gateway library for XMPP built in Python, and a set of gateways for other networks. other networksslidgeimgatewaysxmpp https://www.rs-online.vn/c/electrical-automation/automation-gear/iot-gateways/ IoT Gateways Archives - RS Components Vietnam IoT (Internet of Things) Gateways are industrial devices designed to provide device-to-device or device-to-cloud platform communication, linking sensors,... iot gatewaysarchivesrscomponentsvietnam https://routerstore.com/product-category/manufacturers/teltonika/ Teltonika Routers, Gateways & Switches | Official UK Teltonika Distributor Shop Teltonika industrial 4G and 5G routers, IoT gateways, and network switches from an official UK Diamond Partner. UK stock, fast delivery, RMS support, and... teltonikaroutersgatewaysswitchesofficial https://icpdas-usa.com/converters_and_gateways.html Converters & Gateways | ICP DAS USA Inc - Data Acquisition data acquisitionconvertersgatewaysicpdas https://www.hms-networks.com/products/building-automation/ac-cloud-control-gateways AC cloud control gateways Control your AC remotely with AC Cloud Control Gateways. Integrate with the cloud for smart monitoring, automation, and efficient HVAC management anywhere. cloud controlacgateways https://git.sr.ht/~singpolyma/cheogram ~singpolyma/cheogram - Frontend for XMPP gateways to SMS - sourcehut git frontendxmppgatewayssmssourcehut https://www.shopify.com/payment-gateways Payment Providers and Online Payment Gateways (2026) - Shopify A comprehensive list of online international payment gateway providers that integrate with the Shopify platform. payment providersonlinegatewaysshopify https://www.commercegate.com/secure-and-scalable-adult-payment-gateways-for-high-risk-merchants/ Secure and Scalable Adult Payment Gateways for High-Risk Merchants Discover the best adult payment gateway solutions for high-risk businesses. Ensure security, scalability, and compliance for seamless payment. high risk merchantspayment gatewayssecurescalableadult https://global.iu.edu/presence/gateways/europe/index.html Europe: Global Gateways: Our Presence: IU Global: Indiana University Learn about IU’s Europe Gateway. our presenceindiana universityeuropeglobalgateways https://robustel.com/ Industrial 5G/4G/LTE IoT Routers, Gateways & Modems | Robustel Apr 9, 2026 - 5G/4G/LTE industrial routers, gateways and modems delivering secure cellular IoT connectivity for PLCs, sensors, vehicles, cameras, and more. 4g lteindustrial5giotrouters https://www.payram.com/blog/what-are-the-best-crypto-payment-gateways-the-2025-definitive-guide What are the Best Crypto Payment Gateways? The 2025 Definitive Guide | PayRam Aug 27, 2025 - Find the best crypto payment gateway for your business. Our 2025 guide compares top processors on fees, security, and features to help you make an informed... crypto payment gatewaysthe bestdefinitiveguide https://www.terabitsystems.com/juniper/legacy-products/services-gateways/srx-series/spares-and-accessories SRX Series Spares and Accessories | Juniper Services Gateways Specialists in Juniper Networks, Arista Networks, Dell servers, and Cisco as well as other internet hardware brands. Superior Service and Knowledge. Call us at... srxseriessparesaccessoriesjuniper https://www.pulsenetwork.com/public/processing-and-gateways/ Debit Processing and Gateways | PULSE Network PULSE® gateway and processing services give you the flexibility to build your debit program your way, helping you deliver more. debitprocessinggatewayspulsenetwork https://cryptwerk.com/company/passimpay/ Passimpay - reviews, contacts & details | Payment gateways | Crypto services PassimPay — a powerful financial tool for businesses and for personal use We created PassimPay to help entities and individual users quickly... payment gatewayscrypto servicesreviewscontactsdetails https://www.cloudvue.io/cloud-gateways Cloudvue Gateways — Cloudvue Video Surveillance and Access Control video surveillanceaccess controlcloudvuegateways https://www.greynoise.io/blog/credential-based-campaign-cisco-palo-alto-networks-vpn-gateways Coordinated Credential-Based Campaign Targets Cisco and Palo Alto Networks VPN Gateways GreyNoise is tracking a coordinated, automated credential-based campaign targeting enterprise VPN authentication infrastructure, with activity observed against... palo alto networkscoordinatedcredentialbasedcampaign https://www.method.me/features/payment-gateways/ CRM Payment Gateways for QuickBooks users — Method Dec 10, 2025 - Finally, QuickBooks payment processing from your CRM. Choose your payment gateway of choice with Method and sync transactions to QuickBooks. payment gatewayscrmquickbooksusersmethod https://www.direktronik.se/direktronik/overvakning/automationscada/lorawan-gateways/ LoRaWAN Gateways - Direktronik AB Oavsett om du söker gateway för inomhusmiljö eller tuff industriell utomhusmiljö så har vi rätt LoRaWAN gateway för dig. Nu kan du få våra speciellt utvalda... lorawan gatewaysab https://www.rtautomation.com/ Real Time Automation, Inc. - Connectivity Products, Protocol Gateways & Embedded Stacks real timeconnectivity productsautomationincprotocol https://www.mulesoft.com/webinars/ai-agents-gateways-preparation AI Agents & AI Gateways: How to Be Prepared | MuleSoft Join our MuleSoft webinar to learn about AI agents and AI gateways. Discover how to prepare your business for the future of AI technology. Register now! ai agentshow tobe preparedgatewaysmulesoft https://gatewaystoart.liber3.eth.limo/ Gateways to Art: Understanding the Visual Arts Third Edition visual artsgatewaysunderstandingthirdedition https://www.careersinfosecurity.co.uk/hacked-devices-are-gateways-for-chinese-nation-state-hackers-a-31490 Hacked Devices Are Gateways for Chinese Nation-State Hackers Networks comprised of hacked domestic devices underpin a mounting number of Chinese nation-state hacking operations, warned British, U.S. and a slew of other hackeddevicesgatewayschinesenation https://www.ilgateways.com/ Gateways to Opportunity - Gateways to Opportunity gatewaysopportunity https://iottechnews.com/categories/networking/gateways-cloud-connectivity/ Gateways & Cloud Connectivity Archives - Internet of Things News Learn how gateways and cloud connectivity platforms integrate IoT devices and systems. internet of thingscloud connectivitygatewaysarchivesnews https://www.virginatlanticcargo.com/gb/en/our-network/worldwide-offices.html Offices and gateways | Virgin Atlantic Cargo Wherever you are, Virgin Atlantic Cargo is never far away virgin atlanticofficesgatewayscargo https://www.nokia.com/asset/214741/ Nokia: Connecting clouds with Nokia Data Center Gateways The role of Data Center Gateways (DCGWs) is becoming more important and demanding as more organizations make artificial intelligence a key part of th data centernokiaconnectingcloudsgateways https://www.commercegate.com/essential-features-payment-gateways-high-risk/?_gl=1*fxjare*_up*MQ..*_ga*MTAxOTE0MjA4Ny4xNzQwMDcwMjU3*_ga_0K2GBDVPRZ*MTc0MDA3MDI1Ny4xLjAuMTc0MDA3MDI1Ny4wLjAuMA.. Essential features to look for in Payment Gateways for High-Risk Businesses - CommerceGate Nov 18, 2024 - Explore key payment gateway features for high-risk businesses, including fraud prevention, chargeback tools, and compliance. payment gatewayshigh riskessentialfeatureslook https://kb.fanso.io/knowledgebase/payment-gateways-faqs/ Payment Gateways - FAQ's - Fanso Knowledge Base payment gatewaysknowledge basefaqfanso https://beronet.atlassian.net/wiki/spaces/PUB/pages/51085427/FAQ+-+Gateways+Card FAQ - Gateways & Card - beroNet Documentation - Confluence faqgatewayscarddocumentationconfluence https://www.haproxy.com/blog/asymmetric-routing-multiple-default-gateways-on-linux-with-haproxy Linux Asymmetric Routing Using Multiple Default Gateways May 18, 2023 - In this blog post, we will demonstrate how to perform asymmetric routing and multiple default gateways on Linux with HAProxy. linuxroutingusingmultipledefault https://ambientmesh.io/docs/traffic/gateways/ Gateways – Ambient Mesh A gateway is a proxy at the edge of an ambient mesh. A Gateway can be used to allow traffic to ingress or egress. Creating an ingress gateway Like waypoints,... ambient meshgateways https://woocommerce.com/product-category/payment-gateways WooCommerce Payment Gateways Take payments with the provider that’s right for you - choose from a large range of payment gateways for WooCommerce. payment gatewayswoocommerce https://global.iu.edu/presence/gateways/asean/index.html ASEAN (Bangkok): Global Gateways: Our Presence: IU Global: Indiana University Learn about IU’s ASEAN Gateway, located in Bangkok, Thailand. our presenceindiana universityaseanbangkokglobal https://www.omadanetworks.com/us/business-networking/omada-router-5g-4g-wifi-router/ 4G/5G WiFi Gateways | TP-Link TP Link - 4G/5G WiFi Gateways tp link4g5gwifigateways https://www.peerspot.com/categories/soa-application-gateways/shortlist SOA Application Gateways Recommendation Wizard Top SOA Application Gateways solutions. Compare the best-rated products based on verified user reviews and expert insights. soa application gatewaysrecommendationwizard https://www.EasyStoreCreator.com/payment-gateways EasyStoreCreator: Secure Payment Gateways & E-commerce Integration Secure and reliable payment gateways integrated directly into your EasyStoreCreator shop. Process credit cards safely and instantly with our fully PCI... secure paymentgatewayscommerceintegration https://zbookstore.com/s/1092/gateways-grind Book: Gateways Grind by Shady Lady Julie A love story between two women that started back when such things were frowned on by society. It highlights the most wonderful Gateways Club that was a real... shady ladybookgatewaysgrindjulie https://www.payoneer.com/resources/business/b2b-payment-gateway-guide/ A Comprehensive Guide to B2B Payment Gateways Apr 20, 2026 - Discover how B2B payment gateways work, what features to look for, and how to choose the right solution for secure, scalable, cross-border business payments. a comprehensive guidepayment gatewaysb2b https://www.ilgateways.com/financial-opportunities/scholarship/what-are-my-responsibilities What are my responsibilities? - Gateways to Opportunity responsibilitiesgatewaysopportunity https://www.omadanetworks.com/us/business-networking/omada-pro-router-wired-router/ Wired Gateways | TP-Link TP Link - Wired Gateways wired gatewaystp link https://miro.co.za/brand/14-grandstream Grandstream South Africa | VoIP & IP Telephony, PBXs, WiFi, Routers & Gateways, Surveillance Together with Grandstream in South Africa, MiRO has been empowering businesses to achieve maximum productivity through award-winning hardware since 2005. south africaip telephonywifi routersgrandstreamvoip https://developers.xsolla.com/payment-ui-and-flow/features/gateways/ Xsolla Documentation – Gateways Follow our developer documentation to integrate Xsolla products step-by-step or customize your solution with our APIs. xsolladocumentationgateways https://www.hms-networks.com/computing-gateways Computing gateways | Vehicle Communication | Automotive Computing gateways – integrate in-vehicle communication with factory automation, enable high-performance gateway applications and data logging. computinggatewaysvehiclecommunicationautomotive https://woocommerce.com/product-category/woocommerce-extensions/payment-gateways/ WooCommerce Payment Gateways Take payments with the provider that’s right for you - choose from a large range of payment gateways for WooCommerce. payment gatewayswoocommerce https://gateways.med.brown.edu/ Gateways | Medical School | Brown University The Master of Science in Medical Sciences Program is part of the Gateways Program at The Warren Alpert Medical School of Brown University. This special masters... medical schoolbrown universitygateways https://kb.fanso.io/knowledgebase-category/payment-gateways/ Payment Gateways Archives - Fanso Knowledge Base payment gatewaysknowledge basearchivesfanso https://dcmslibraries.blog.gov.uk/2025/10/29/collaboration-is-the-key-public-libraries-as-gateways-to-nature/ Collaboration is the Key -public libraries as gateways to nature – DCMS Libraries In an era where connection - to nature, community, and wellbeing - is more important than ever, Culture Nature England (CNE) is helping to open up new... the keypublic librariescollaborationgatewaysnature https://kgateway.dev/blog/advancing-open-source-gateways/ Advancing Open Source Gateways with the CNCF and kgateway – kgateway At KubeCon NA 2024, Solo.io announced its intention to donate the Gloo Gateway open source project to the CNCF, to enrich the broader cloud native ecosystem.... open sourceadvancinggatewayscncfkgateway https://www.payram.com/blog/digital-currency-global-playgrounds-the-crypto-transformation-reshaping-online-gaming-in-2025 Self-Hosted Crypto Gateways for iGaming: The 2025 Sovereign Operator Guide self hostedfor igamingcryptogatewayssovereign https://www.halcolighting.com/c/products-solutions/halco-lighting-technologies/controls/network-devices/gateways-time-keepers.html Gateways-Time Keepers - Network Devices - Controls - Halco Lighting Technologies - Products &... network devicesgatewaystimekeeperscontrols https://www.payram.com/blog/self-hosted-crypto-payment-gateways-reclaim-your-financial-destiny-in-2025-with-payram Self-Hosted Crypto Payment Gateways: Reclaim Your Financial Destiny in 2025 with PayRam crypto payment gatewaysself hostedin 2025reclaimfinancial https://devrix.com/portfolio/implementing-multiple-payment-gateways/ Multiple Payment Gateways for X-POLE | Case Studies Mar 31, 2025 - Explore how DevriX delivered a frictionless checkout experience across regions through smart, compliant payment gateway integrations. payment gatewayscase studiesmultiplepole https://www.audiocodes.com/solutions-products/products/products-for-microsoft-teams/media-and-analog-gateways-for-microsoft-teams Media and Analog Gateways for Microsoft Teams A comprehensive range of Media and Analog Gateways designed to seamlessly integrate existing enterprise voice infrastructures with Microsoft Teams environments. microsoft teamsmediaanaloggateways https://www.networkworld.com/article/2132221/att-taps-cisco-fixed-5g-wireless-gateways-for-wan-service.html AT&T taps Cisco fixed 5G wireless gateways for WAN service | Network World service networktapsciscofixed5g https://forum.dfinity.org/tag/http-gateways/139 Topics tagged HTTP-Gateways Topics tagged HTTP-Gateways topicstaggedhttpgateways https://www.duocircle.com/content/smtp-gateways What Are SMTP Gateways? - DuoCircle SMTP gateways are used when you send emails, but you might not know their exact job. Find out all about them in this article. smtp gatewaysduocircle https://www.hostinger.com/support/6538413-hostinger-website-builder-online-payment-gateways/ Hostinger Website Builder: Online Payment Gateways Enabling online payments in your online store created with Hostinger Website Builder hostinger website builderonline paymentgateways https://viserlab.com/product/paymenthub-simplify-online-payment-with-multiple-gateways/210 PaymentHUB - Simplify Online Payment With Multiple Gateways by ViserLab PaymentHUB - Simplify Online Payment With Multiple Gateways. PaymentHub is a powerful and secure online payment gateway platform designed to simplify payment... online paymentmultiple gatewayssimplifyviserlab https://www.ssv-embedded.de/en/products/ Products: Gateways, Starter Kits, Accessories, Customizing | SSV Software Systems GmbH Products: Gateways, Starter Kits, Accessories, Customizing starter kitssoftware systemsproductsgatewaysaccessories https://www.pcworld.com/article/2938383/broadcom-launches-next-gen-wi-fi-8-silicon-for-home-gateways-handhelds.html Broadcom launches next-gen Wi-Fi 8 silicon for home gateways, phones | PCWorld Oct 14, 2025 - Broadcom has begun sampling key Wi-Fi 8 silcion to partners, even though the formal specification isn't expected to be approved for several years. Each chip... next genwi fifor homebroadcomlaunches https://www.weebly.com/online-store/payment-gateway Payment Gateways for Your Online Store Instantly accept major credit cards directly from your own domain. Choose from a variety of payment options including Stripe, PayPal, and Square. payment gatewaysonline store https://www.bigcommerce.co.uk/payments/ Online Payment Gateways & Credit Card Solutions | BigCommerce Connect your online store with leading payment gateways. Solutions such as PayPal powered by Braintree, Stripe, and Square improve shopper experience and... online paymentcredit cardgatewayssolutionsbigcommerce https://www.gravitee.io/blog/api-solution-architecture-role-of-api-gateways API Solution Architecture: The Role of API Gateways in Secure and Scalable Systems Aug 22, 2025 - API solution success relies on secure, scalable design. Discover how Gravitee API Gateway empowers modern systems with control, performance, and flexibility. api solutionarchitecturerolegatewayssecure https://support.milesight-iot.com/support/solutions/articles/73000596556-lorawan-gateways-faq-october-2022 LoRaWAN Gateways FAQ-October 2022 : IoT Support lorawan gatewaysoctober 2022faqiotsupport https://www.enghousevideo.com/gateways Telco Gateways | Enghouse Video Dec 4, 2025 - Explore Aculab’s telco gateways for seamless IP and TDM interworking, protocol conversion, and application extension—trusted globally for reliability,... telcogatewaysvideo https://www.lantronix.com/products-class/iot-gateways/ Industrial IoT Gateways, Routers & Modems | 4G LTE & 5G | Lantronix Apr 30, 2026 - Rugged 4G LTE and 5G gateways, routers, and modems for OEMs and system integrators. Lantronix IIoT connectivity hardware supports cloud integration, edge... industrial iot4g ltegatewaysroutersmodems https://www.omadanetworks.com/us/business-networking/omada-pro-router-4g-wifi-router/ 4G/5G WiFi Gateways | TP-Link TP Link - 4G/5G WiFi Gateways tp link4g5gwifigateways https://bebeez.eu/gateways-to-italy/ Gateways to Italy – Offer your services to funds and investors willing to explore opportunities in... your servicesexplore opportunitiesgatewaysitalyoffer https://global.iu.edu/presence/gateways/index.html Global Gateways: Our Presence: IU Global: Indiana University Indiana University has Global Gateways in locations around the world. Learn more about what we offer. our presenceindiana universityglobalgatewaysiu https://www.ssv-embedded.de/produkte/gateways Gateways für industrielle Kommunikation und Industrie 4.0- sowie IoT-Anwendungen | SSV Software... Gateways für industrielle Kommunikation und Industrie 4.0- sowie IoT-Anwendungen 4 0gatewaysindustriellekommunikationund https://www.shopify.com/blog/best-payment-gateways The 6 Best Payment Gateways for Merchants (2026) - Shopify Looking for a new payment gateway to process online payments? This guide evaluates seven of the best options by features, strengths, and pricing. payment gatewaysfor merchantsbestshopify https://www.aveloair.com/airports Avelo Airlines Airports | Convenient Gateways to Your Next Adventure Oct 1, 2025 - Explore Avelo Airlines' airports, your convenient gateways to adventure. Discover our diverse airport locations and amenities. airlinesairportsconvenientgatewaysnext https://www.stanthonysf.org/ Essential Services, Health Care & Gateways to Stability | St. Anthony's Apr 20, 2026 - St. Anthony's provides essential services, health care, and gateways to stability to families and individuals in need in the San Francisco area. essential serviceshealth caregatewaysstabilityanthony https://www.wix.com/payments/payment-gateways All payment gateways | Wix.com Find the best payment solution for your business. Get paid online—connect Wix Payments or choose from 50+ online payment gateways worldwide. payment gatewayswix https://freenet.org/about/news/weekly-dev-meeting-2024-09-14/ Weekly Dev Meeting - Gateways and Peer Connections | Freenet peer connectionsweeklydevmeetinggateways https://www.insys-icom.com/produkte/router-gateways/ Router & Gateways für die Industrie – von INSYS icom routergatewaysdieindustrievon https://hostbillapp.com/hostbill/automatedbilling/paymentgateways/ Payment Gateways | HostBill | Billing & Automation Software for WebHosts payment gatewaysbilling automationhostbillsoftwarewebhosts https://northernep.com/products/gateways/ Gateways - NEP – Northern Electric Power Sep 25, 2023 - Statement of USA Silicon Valley headquarters, leading microiverters and rapid shutdown solutions installed in 35 countries for over 10 years. electric powergatewaysnepnorthern https://botland.store/1346-smart-home-hubs-and-gateways Smart Home hubs and gateways Botland - Robotic Shop A network gateway is a device that allows you to connect networks with different data transmission solutions, such as ZigBee to WiFi or Z-Wave to WiFi. How do... smart home hubsgatewaysroboticshop https://vitec.com/products/ip/rf-gateways-transcoders VITEC: VITEC IP/RF Gateways and Transcoders Experience efficient video encoding and decoding processes using our state of the art IP/RF gateways and transcoders. iprfgateways https://www.websitebuilder.nz/payment-gateways.html Compare payment gateways for online shopping cart websites - Website World payment gatewaysonline shoppingwebsite worldcomparecart https://robustel.com/pt/ Industrial 5G/4G/LTE IoT Routers, Gateways & Modems | Robustel Apr 9, 2026 - 5G/4G/LTE industrial routers, gateways and modems delivering secure cellular IoT connectivity for PLCs, sensors, vehicles, cameras, and more. 4g lteindustrial5giotrouters https://docs.arcade.dev/en/guides/mcp-gateways MCP Gateways | Arcade Docs Connect multiple MCP servers to your agent, application, or IDE with Arcade MCP Gateways mcpgatewaysarcadedocs https://www.tp-link.com/us/business-networking/soho-festa-gateway/ Gateways | TP-Link tp linkgateways