Robuta

https://foxbriarinn.com/ Home - Fox Briar Inn | Cozy Bed & Breakfast Getaway fox briarcozy bedinnbreakfastgetaway https://www.mtunziniforestlodge.co.za/ Mtunzini Forest Lodge | Relaxing Coastal Getaway in KwaZulu-Natal | Gooderson Mtunzini Forest Lodge Escape to Mtunzini Forest Lodge in KwaZulu-Natal – a peaceful coastal retreat offering self-catering cabins, nature, and relaxation near the beach. forest lodgekwazulu natalmtunzinirelaxingcoastal https://eurisles.com/ Eurisles.com - European Island Getaway Domain Discover eurisles.com, a unique domain name suggesting European island travel and leisure. Inquire about this domain. island getawayeuropeandomain https://portland.staywithpool.com/ The Best 16 Portland Hotels with Pool - Find Your Perfect Getaway Hi, I’m Freeda Breitenberg and I work as a Sports Coach. Over the years, I have traveled to many different cities and always make sure to stay in a hotels with poolthe bestfind yourportland https://www.visitmckinney.com/ McKinney Texas Travel Guide | Your Perfect Vacation Getaway Start your McKinney adventure! Explore charming parks, amazing dining, exciting events, and hidden gems—perfect for a memorable getaway. texas travel guideperfect vacationmckinneygetaway https://startupgetaway.co/ Startup Getaway Co: Premium Domain Listing Startupgetaway.co offers a unique brand identity for startup retreats, innovation getaways, and tech company offsites. premium domainstartupgetawaycolisting https://www.visitpa.com/ Visit Pennsylvania | Your Great American Getaway In Pennsylvania, backroads become stories, festivals become legends, and every town has a twist. great americanpennsylvaniagetaway https://www.mountaingetaway.co/ Mountain Getaway - Your Guide To Summer Mountain Travel by OnTheSnow guide to summertravel bymountaingetawayonthesnow https://www.twinfarms.com/ Twin Farms | Vermont Luxury Resort | All Inclusive Getaway May 27, 2026 - Award-Winning Hotel and spa on three hundred acres of wildflowers, rolling hills, wandering trails. Offers information on accommodations, dining, events and... resort all inclusivetwin farmsvermontluxurygetaway https://houseoftheveryislands.com/ houseoftheveryislands.com - Tropical Getaway Domain houseoftheveryislands.com is a unique .com domain, perfect for island resorts or travel sites. tropical getawaydomain https://getawaymerimbula.com.au/ Getaway Merimbula Jul 10, 2026 - Home - Penthouse holiday accommodation with amazing water views in the heart of Merimbula getawaymerimbula https://www.dhawa.com/ Dhawa: Contemporary Full-service Hotel & Spa Getaway Experience contemporary style and comfort with Dhawa, a full-service boutique hotel brand renowned for personalised service and innovative design. full service hoteldhawacontemporaryspagetaway https://thehotelbritomart.com/ The Hotel Britomart - A getaway in downtown waterfront Auckland Jun 25, 2023 - Voted NZ’s #1 Hotel, soulful, smart and contemporary, the rooms at The Hotel Britomart are havens of calm in the bustle of downtown waterfront Auckland the hotel britomartin downtowngetawaywaterfrontauckland https://www.greatnortherncatskills.com/ Great Northern Catskills | Discover Your Perfect Getaway Plan your Greene County, NY getaway in the Great Northern Catskills — mountain trails and waterfalls, farm-to-table dining, festivals, and cozy stays across... great northern catskillsdiscoverperfectgetaway https://www.minocqua.org/ Visit Minocqua Wisconsin | Northwoods Getaway Travel Start planning a peaceful getaway today surrounded by waterways, forests, scenic towns, family traditions, and four-season regional charm. minocquawisconsinnorthwoodsgetawaytravel https://www.huntermtn.com/ New York's Skiing & Adventure Getaway | Hunter Mountain Resort new yorkhunter mountainskiingadventuregetaway https://meditationinflorida.org/ Florida Peaceful Getaway Retreat floridapeacefulgetawayretreat https://www.visitwhitemountains.com/ White Mountains, NH Travel | Getaway, Vacation & Trip Ideas Start planning your escape to the White Mountains. Enjoy outdoor beauty, scenic drives, cozy lodging, seasonal events, and stunning views. white mountainsvacation tripnhtravelgetaway https://foreverbungalows.com/ Discover foreverbungalows.com, Your Tropical Getaway foreverbungalows.com is offered. Inquire to acquire this unique domain name and start building your brand. discovertropicalgetaway https://visithillsboroughnc.com/ Visit Hillsborough, NC | The getaway you've been waiting for... Jul 7, 2026 - Hillsborough is the perfect getaway for a day or weekend trip. Explore history, art, live music, unique shops, and award-winning restaurants. hillsborough ncthe getawaywaiting https://www.curacao.com/ Curaçao: the Caribbean Getaway to Feel for Yourself Here in Curacao, you're free to explore every inch of our Caribbean paradise. Start planning your trip today, and Feel It For Yourself. the caribbeangetawayfeel https://greeceyogaretreat.com/ Getaway to Greece Yoga Retreat Join us for a renew-your-senses yoga experience on the exotic Greek Island, Amorgos, filled with healthy foods, lots of yoga and fun adventures not to be... getawaygreeceyogaretreat https://visitnewcastle.com.au/ Enjoy a weekend getaway in NSW | Visit Newcastle - Visit Newcastle A 2hr drive from Sydney sitting on the doorstep to the Hunter Valley, find out why Newcastle is a perfect location for weekend getaways in NSW a weekendenjoygetawaynswnewcastle https://nisquallyriverretreat.com/ Riverfront family getaway near Mt. Rainier - Nisqually River Retreat May 27, 2025 - Nisqually River Retreat is a 3 bedroom, 2 bathroom vacation home in the lush foothills below Mt. Rainier where peace or adventure await! family getawaymt rainierriverfrontnearnisqually https://www.blueoctobergetaways.com/ Cabo 2026 | Blue October Getaway blue octobercabogetaway https://resortsbase.com/ Unlock Your Getaway with ResortsBase.com ResortsBase.com is a premium domain offered. Inquire about this unique web address. unlockgetaway https://oagaresorts.com/ Your Maldives Resort Getaway | Oaga Art Resort Jun 27, 2026 - Your luxury getaway awaits at Oaga Art Resort. Relax in our stunning, art-inspired villas and discover a sanctuary of authentic Maldivian well-being. maldives resortgetawayart https://www.bluemountain.ca/plan-your-trip/deals-and-packages/explore-the-escarpment Explore the Escarpment Getaway | Blue Mountain Resort Two Nights of Accommodation in room type of your choice explore theblue mountainescarpmentgetawayresort https://bluecottagebb.ca/ 70 Mile House Accommodation | South Cariboo Weekend Getaway Stay at comfortable 70 Mile House accommodation near Green Lake BC, Cariboo Wagon Road, and Gold Rush Trail in the 100 Mile House area — perfect for a South... mile housesouth caribooaccommodationweekendgetaway https://www.aranyabystories.com/ best Luxury weekend getaway Spa resorts in jaipur with activites* May 13, 2026 - Escape to tranquility at Aranya By Stories, offering the finest luxury spa resorts near Jaipur with activites*. Indulge in rejuvenating treatments, explore... weekend getawayspa resortsbestluxuryjaipur https://walnutcanyoncabins.com/ Walnut Canyon Cabins | Fredericksburg, USA Getaway Relax and be inspired at Walnut Canyon Cabins in Fredericksburg, USA. Book your peaceful cabin retreat online today and experience comfort in the Texas Hill... walnut canyon cabinsfredericksburgusagetaway https://newbuffaloexplored.com/stay/marina-grand-resort/ Marina Grand Resort: A Perfect No-Plan-Needed Michigan Getaway Nov 3, 2025 - An extensive remodel brought luxe upgrades to this waterfront boutique hotel on New Buffalo harbor. Flat-style guestrooms, fireside communal spaces, and a... grand resortno planmarinaperfectneeded https://www.amherstinnma.com/ Welcome to Amherst Inn - Your Historic Victorian Bed and Breakfast Getaway Welcome to Amherst Inn - Your Historic Victorian Bed and Breakfast Getaway bed and breakfastwelcome toamherstinn https://thecliff.co.in/ The Ultimate Getaway in Panchgani - The Cliff by Zuper Welcome to Panchgani's Jewel Crown, The Cliff which offers magical valley lake views, spacious rooms, world class dining and more. the ultimategetawaypanchganicliffzuper https://summersvillelakeretreat.com/ Summersville Lake Retreat & Lighthouse | An Unforgettable Camping Getaway Jan 7, 2026 - Voted Best Campground in West VirginiaFor the 4th year in a row we were voted Best Campground in West Virginia. summersville lakeretreatlighthouseunforgettablecamping https://campwilddhauj.in/ Aravali Hills Weekend Getaway | Camp Wild Farm Retreat Experience rustic AC cottages, a pool, organic meals, and scenic Aravali Hills with adventure and team-building activities for corporate events. weekend getawaycamp wildaravalihillsfarm https://mytravelset.us/ My Travel Set | Embark On Your Next Getaway In Style Aug 11, 2025 - We’re bringing back the glory days of air travel. Our trendy yet timeless styles pair seamlessly with the rest of your wardrobe. It’s never been easier to look... my travelsetembarknextgetaway https://www.explorekawarthalakes.com/ Kawartha Lakes | Quietly Incredible Ontario Getaway The official website for City ofDiscover Kawartha Lakes, a quietly incredible destination in the heart of Ontario. Explore scenic waterways, charming small... kawartha lakesquietlyincredibleontariogetaway https://hotlakespringsresort.com/ Hot Lake Springs Resort - Peaceful Getaway in Historic Hot Springs Jun 28, 2026 - Natural mineral hot springs soaking and lodge stays at Hot Lake Springs Resort in La Grande, Oregon. Book your restorative getaway today. hotlakespringsresortpeaceful https://weekender.hospitalitydnb.com/ Hospitality Weekender 2027 - Drum & Bass Winter Getaway in Bognor Regis winter getawayhospitalityweekenderdrumbass https://samoanaresort.com/ Samoanaresort.com: Tropical Getaway Domain Samoanaresort.com, a premium .com domain, ideal for a Polynesian-themed resort website. tropical getawaydomain https://thegardengetaway-wa.com/ The Garden Getaway | Farmhouse Rental in Stanwood Washington Book your vacation rental in Stanwood Washington, the Farmhouse overlooks the stunning flower fields during the growing season of our flower farm. Sip your... the gardenfarmhouse rentalgetawaystanwoodwashington https://hornseavillage.com/ Welcome to Your Perfect Getaway | Hornsea Village Apr 9, 2026 - Discover Hornsea Village, your ideal destination for family fun, shopping, outdoor activities, and unique experiences for all ages. welcome toperfectgetawayhornseavillage https://alberthotel.com/ A Texas Hill Country Getaway | Albert Hotel | Fredericksburg, TX Albert Hotel is an honest Texas Hill Country getaway, a boutique hotel located in Fredericksburg, TX. texas hill countrygetawayalberthotelfredericksburg https://enclaveloyalist.ca/ Enclave - A Loyalist Country Club Community by Kaitlin Corp. | Your own private getaway in the... https://drive.google.com/file/d/1xhAhau5dcU6TKw6PoDkDWG9XeTv1JLGU/view?usp=sharing Discover Clarion County Getaway Guide 2026-2027.pdf - Google Drive clarion countygetaway guidediscoverpdfgoogle https://leavetown.com/ Leavetown - Find your perfect getaway in spectacular locations! Find the best vacation rentals find your perfect getawayspectacularlocations https://getawayoutdoorskelmscott.com.au/ Getaway Outdoors Kelmscott Getaway Outdoors Kelmscott getawayoutdoorskelmscott https://www.avithosresort.com/ Avithos Resort - Your Ideal Kefalonia Getaway | 4 Star Hotel Experience the ultimate holiday at Avithos Resort in Svoronata, Kefalonia. A unique 4-star resort offering luxury accommodation with self-catering studios,... resortidealkefaloniagetawaystar https://northwoodsmainecabins.holidayfuture.com/ North Woods Maine Cabins: Your Ultimate Retreat | Vacation Rentals for a Serene Getaway "Escape to the heart of nature with our North Woods Maine cabins vacation rentals. Experience serenity in cozy retreats surrounded by breathtaking landscapes.... https://letoinyexclusive.com/ Le Toiny St. Barth - Exquisite Villas for a Luxurious Getaway Jun 18, 2025 - Private luxury villa rentals in St. Barth with exclusive 5-star services from Hôtel Le Toiny. Private pools, ocean views, beach access, spa, and fine dining... st barthletoinyexquisitevillas https://roadadventures.com/ Road Adventures by Mark Wahlberg – The Great American Getaway road adventuresby markthe greatwahlbergamerican https://pukakilakesidegetaway.co.nz/ Home - Pukaki Lakeside Getaway Oct 7, 2025 - Stay at Pukaki Lakeside Getaway on Lake Pukaki’s turquoise shores. Self-contained cottages and houses near Twizel with stunning Mount Cook views. pukakilakesidegetaway https://mameresguesthouse.com/ Downtown Monmouth, OR Bed and Breakfast | Monmouth Getaway Oct 28, 2025 - Our Monmouth OR bed and breakfast offers wimysical rooms, expansive sitting areas, full breakfast, outdoor sitting areas and more. Book Today bed and breakfastdowntownmonmouthgetaway https://shadrack-resort.com/ Shadrack Resort: Your Perfect Getaway Destination Experience luxury at Shadrack Resort. Book your nightly stay today and enjoy stunning views and exceptional service at our premier resort. shadrackresortperfectgetawaydestination https://www.blisswood.net/ Romantic Getaway in Texas | 350-Acre Dude Ranch near Houston romantic getawayin texasdude ranchacrenear https://golfhub.golfgenius.com/events/8f1074b3-893c-46e2-9b84-96e6037a3e44 IGA/WA Golf Ladies Golf & Wine Getaway igawagolfladieswine https://www.bellingham.org/plan Plan Your Next Big Getaway in Bellingham, Whatcom County Use our easy to navigate page to find itineraries, lodging, current events, and more to help you plan your trip. Visit Bellingham and Whatcom County for your... plan yournext biggetawaybellinghamwhatcom https://gallery.clubvipplus.com/ Home - The Getaway Gallery the getawaygallery https://thesixbellshotel.com/ The Six Bells Inn | A Cozy Countryside Getaway Experience The Six Bells, a historic Hudson Valley inn, shop, tavern, and event space known for its elegant design and old-world charm. the six bellsinncozycountrysidegetaway https://www.atlanticahotels.com/ Atlantica Hotels & Resorts | Find Your Perfect Getaway hotels resortsfind youratlanticaperfectgetaway https://nazarbagh.com/ Nazarbagh: Best Royal Destination Wedding Venue, Private Resort, Weekend getaway location in Jaipur... Book the most popular and best destination wedding venue in Jaipur, private function venue, best wedding venue, private resort in Jaipur for Royal hospitality.... destination wedding venue https://www.cottageinnhotel.co.uk/ Welcoming The Cottage Inn: Your Craster Getaway Discover warm hospitality and local flavours at The Cottage Inn Craster. Enjoy peaceful gardens, coastal walks, and local dishes in the heart of Northumberland. the cottage innwelcomingcrastergetaway https://www.crystalgolfresort.com/ Golf Resort & Hotel Getaway near NYC | Crystal Springs Resort in NJ Crystal Springs Resort is a spectacular NJ vacation destination, acclaimed as the New York Metro area's most unique four-season world-class resort. golf resortnear nyccrystal springshotelgetaway https://littlebearalaska.com/ Lodging On Glenn Hwy | Little Bear Getaway Cabins little bearlodgingglennhwygetaway https://destinationdutchess.com/ Destination Dutchess | Hudson River Valley Getaway Begin your Hudson River Valley getaway here, in Dutchess County! Sure, it's easy to get here - by car, train, bus and air. hudson river valleydestinationdutchessgetaway https://getawayoutdoorsbalcatta.com.au/ Getaway Outdoors - Balcatta The Getaway Outdoors family began in the Balcatta store in 1991, with Carrole dedicating 30 years to the company and its customers. After spending half her life getawayoutdoorsbalcatta https://getawayflyfishing.com/ Home - Getaway Fly Fishing May 19, 2026 - Check out our destinations Greenland Arctic char view destination Acklins island bonefish club view destination Nicaragua Jungle tarpon view destination... getawayflyfishing https://getaway.pro/ GETAWAY Pro Mit GETAWAY kontrollieren Sie Ihre Flotte in Echtzeit mit allen Geschäftsprozessen an einem Ort ✓ Whitelabel Apps ✓ Operations ✓ Telematik-Hardware getawaypro https://www.beachretreatsbyvillage.com/ Discover Your Perfect Outer Banks Getaway with Beach Retreats by Village Escape to the Outer Banks with Beach Retreats by Village. Explore charming inns, cozy bungalows, and pet-friendly stays in Ocracoke, Nags Head, and Kill Devil... outer bankswith beachdiscoverperfect https://sg.hotels.com/de1636432/seefeld-in-tirol-austria-hotel-rooms/ Seefeld in Tirol Hotels from S$132 - Top Hotel & deals for the perfect getaway | Hotels.com Flexible booking options on selected hotels. Compare 754 hotels in Seefeld in Tirol using 2,676 real guest reviews. https://www.cherrynudes.com/liloo-in-our-weekend-getaway-at-watch4beauty/ Liloo in Our Weekend Getaway at Watch4Beauty | Cherry Nudes Oct 26, 2025 - Liloo in Our Weekend Getaway at Watch4Beauty. Liloo has a great time peeling off her skirt and being naked outside. our weekendliloogetawaycherrynudes https://citystyleandliving.blogspot.com/2009/03/other-goodies.html City Style and Living Magazine Blog: GIRLFRIEND GETAWAY- LAS VEGAS Lifestyle Blog about Food, Wines and Spirits, Fashion, Travel, and Luxury from award winning magazine, City Style and Living, based in Canada. style and livingmagazine bloggirlfriend getawaycitylas https://us.trip.com/hotels/nulkaba-hotel-detail-7615641/getaway-inn-boutique-guest-house/ Getaway Inn Boutique Guest House in Nulkaba - 2026 Prices & Reviews | Trip.com Plan to book a 3-star hotel in Nulkaba from Getaway Inn Boutique Guest House? Compare prices, explore room options, read reviews, and book your stay on... guest house https://www.aastays.com/ Adventure Awaits | Luxury Vacation Rentals Getaway Adventure Awaits provides luxury vacation experiences for its guests, helping them make memories with friends and families for a lifetime! luxury vacation rentalsadventure awaitsgetaway https://cutelildiary.blogspot.com/2014/04/kuantan-getaway.html My Cute Little Diary: Kuantan Getaway Lama tak bercuti tepi pantai. Akhirnya dapat gak ikut Zaf. Dia ada meeting n main golf kat Kuantan. Kita ikut menyelit sama haha. Kam... cute littlediarykuantangetaway https://homes-and-villas.marriott.com/en/properties/40710579-fredericksburg-charming-getaway-4-min-to-downtown-hot-tub-firepit-grill Charming Getaway 4 Min to Downtown-Hot Tub, Firepit Grill - Home Rental in Fredericksburg Charming haus with hot tub and fire pit, located just a short 3-minute drive from Main Street! This quaint home has 2 bedrooms and 1 bathroom, a living room, an https://sw.airbnb.com/rooms/52185282 Getaway ya Nyumba Ndogo kwenye Acres 13! - Nyumba ndogo ya Kupangisha katika Manor, Texas, Marekani... Getaway ya Nyumba Ndogo kwenye Acres 13! https://www.getaway.pl/ Getaway.pl - Twój asystent podróży getawayplasystent https://www.nps.gov/articles/000/getaway-buis.htm National Park Getaway: Buck Island Reef National Monument (U.S. National Park Service) national parkbuck islandgetawayreefmonument https://www.tmz.com/photos/2023/05/30/saweetie-and-ygs-romantic-cabo-getaway/ Saweetie And YG's Romantic Cabo Getaway Saweetie And YG's Romantic Cabo Getaway saweetieygromanticcabogetaway https://visualvamp.blogspot.com/2009/03/little-getaway-spot-in-france.html?showComment=1237571640000 * v i s u a l * v a m p *: A Little Getaway Spot in France I've only been working full time for three days, and I already could use a little getaway. Actually I'm working two jobs. Decor worker by da... https://sg.hotels.com/de571982/anomabo-ghana-hotel-rooms/ Anomabo Hotels from S$30 - Top Hotel & deals for the perfect getaway | Hotels.com Flexible booking options on selected hotels. Compare 76 hotels in Anomabo using 382 real guest reviews. https://sg.trip.com/hotels/packwaukee-hotel-detail-126806381/tranquil-2-bedroom-getaway-on-private-lake/ Tranquil 2 Bedroom Getaway on Private Lake - 2026 Prices and Deals | Trip.com Find the best deals for Tranquil 2 Bedroom Getaway on Private Lake in Packwaukee, a 3 star hotel. Compare room options, view photos, read reviews and discover... https://www.marriott.com/offers/give-the-gift-of-relaxation-mobile-al-spa-getaway-off-115578/mobbr-mobbr-the-battle-house-renaissance-mobile-hotel-and-spa Give the Gift of Relaxation: Mobile, AL Spa Getaway in Mobile, Alabama | Renaissance Hotels give the gift of relaxation https://jerryshouseofeverything.blogspot.com/2011/11/overlooked-television-getaway-car.html Jerry's House of Everything: OVERLOOKED TELEVISION: THE GETAWAY CAR Today's selection for Todd Mason's Overlooked Films is an episode from Studio 57 , an anthology series that started on the old Dumont Networ... jerry shouse ofthe getawayeverythingoverlooked https://homes-and-villas.marriott.com/en/properties/40550653-dahlonega-game-room-and-fireplaces-group-dahlonega-getaway Game Room & Fireplaces: Group Dahlonega Getaway - Home Rental in Dahlonega game roomhome rentalfireplacesgroupdahlonega https://www.zenra.net/zenra-1799-mature-women-unfaithful-onsen-getaway-enchanting-edition-hd-second-half-subtitles.htm ZENRA | Mature Women Unfaithful Onsen Getaway - Enchanting Edition - Second Half Looking for a real thrill, one married Japanese woman secretly goes on a weekend hot springs getaway for almost nonstop sex. mature womenzenraunfaithfulonsengetaway https://www.marriott.com/offers/wellness-spring-getaway-to-tuscany-off-221267/flrgg-flrgg-grotta-giusti-thermal-spa-resort-tuscany-autograph-collection Wellness Spring Getaway to Tuscany in Monsummano Terme, Italy | Autograph Collection This spring, let yourself be enchanted by a timeless destination. spring getawaymonsummano termewellnesstuscany https://stitchingdream.blogspot.com/2011/11/getaway-weekend-and-giveaway-winner.html Stitching Dreams: Getaway Weekend and Giveaway Winner Good morning everyone! Oh, what a string of glorious fall days we've had here--the sun, the blue skies, the crisp leaves...It's really too b... stitching dreamsgetawayweekendgiveawaywinner https://homes-and-villas.marriott.com/en/properties/40287762-banner-elk-pet-friendly-getaway-w-porch-in-banner-elk Pet-Friendly Getaway w/ Porch in Banner Elk! - Home Rental in Banner Elk pet friendlyin bannerelk homegetawayporch https://biqque.blogspot.com/2013/07/boracay-getaway-batangas-port-caticlan.html?showComment=1372761628464 Beauty In Darkness: Boracay Getaway : Batangas Port, Caticlan Jetty Port, Cagban Jetty Port, and... [ BEFORE ] Boracay Getaway : LCCT and Manila International Airport "Great...we got sniffer dog and 3rd class bunk bed! This is SO not... beauty indarknessboracaygetaway https://sg.hotels.com/de1404711/orlando-florida-hotel-rooms/ Orlando Hotels from S$108 - Top Hotel & deals for the perfect getaway | Hotels.com Flexible booking options on selected hotels. Compare 7,770 hotels in Orlando using 64,977 real guest reviews. https://www.hotels.com/ho3020692192/family-friendly-redmond-getaway-walk-to-dtwn-redmond-united-states-of-america/ Family-friendly Redmond Getaway: Walk to Dtwn, Redmond: Hotel Reviews, Rooms & Prices | Hotels.com View deals for Family-friendly Redmond Getaway: Walk to Dtwn, including fully refundable rates with free cancellation. Weigand Family Dog Park is minutes away.... https://villakanti.com/ 3 to 7 Bedrooms Ubud Private Villa for family getaway or Group, Family Villa KANTI Ubud Bali 5-7... Villa Kanti Ubud Bali is available from 3 to 7 bedrooms luxury private villa for family getaway holiday or yoga retreat. Just 20 minutes to central of Ubud... https://www.aircharterservice.sa.com/en/about-us/news-features/blog/luxury-canada-ski-getaway Luxury Canada ski getaway Escape to the slopes this winter on our private jet charter to Whistler. Stay at a luxurious and contemporary ski-in/ski-out villa in an exclusive... luxurycanadaskigetaway https://homes-and-villas.marriott.com/en/properties/40214950-cape-coral-private-yard-and-pool-stunning-cape-coral-getaway Private Yard & Pool: Stunning Cape Coral Getaway! - Home Rental in Cape Coral private yardcape coralhome rentalpoolstunning https://english.beijing.gov.cn/latest/news/202505/t20250503_4080259.html Beijing Micro-Getaway Guide: Must-Try Delicacies Come and check out these delicious foods in Beijing~ getaway guidemust trybeijingmicrodelicacies https://admissions.dartmouth.edu/follow/blog/caroline-york/weekend-getaway-boston Weekend Getaway to Boston | Dartmouth Admissions May 21, 2022 - A weekend in big-city Boston allowed me to reflect on Dartmouth's unique rural location. weekend getawaybostondartmouthadmissions https://theblackrivercabin.com/ BLACK RIVER GETAWAY CABIN - The Black River Getaway black rivergetawaycabin