Sponsor of the Day:
Jerkmate
https://pureella.com/vegan-dinner-lentil-shepherds-pie/
Lentil Shepherd’s Pie : healthy, vegan & gluten-free
vegan gluten freelentilpiehealthy
https://myquietkitchen.com/oil-free-vegan-banana-brownies/
Healthy Vegan Banana Brownies - My Quiet Kitchen
Jan 20, 2025 - These healthy banana brownies are vegan, oil-free, made with gluten-free oat flour and so delicious! Sweet, moist banana and cake-like texture.
healthy veganquiet kitchenbananabrownies
https://thegreenloot.com/vegan-green-smoothie-recipes/
20+ Healthy Vegan Green Smoothie Recipes | The Green Loot
Mar 8, 2025 - Boost your energy and nutrition intake with these super healthy vegan green smoothie recipes. Made with spinach, protein powder and more filling ingredients.
20 healthyvegan greensmoothie recipesloot
https://viva.ug/health/healthy-vegan-diet/
Healthy vegan diet - Viva! Uganda
healthy veganviva ugandadiet
https://biancazapatka.com/en/about-me/
Hi, I am Bianca! - Bianca Zapatka | healthy vegan & vegetarian recipes!
Dec 30, 2022 - Hey there! Welcome to my blog! I’m Bianca - the writer, photographer, food stylist and recipe developer behind this food blog. You can learn more about me here.
bianca zapatka healthyvegan vegetarian recipeshi
https://biancazapatka.com/en/recipe-index/
Recipe-Index - Bianca Zapatka | healthy vegan & vegetarian recipes!
Nov 20, 2020 - You're looking for healthy vegan recipes, which are quick and easy to make? Then you are at the right place! With over 250 recipes you will surely find...
bianca zapatka healthyvegan vegetarian recipesindex
https://www.pinterest.com/VNutritionist/
VNutrition | Healthy Vegan Recipes (VNutritionist) - Profile | Pinterest
VNutrition | Healthy Vegan Recipes | Find healthy vegan recipes for plant-based diets.
healthy vegan recipesprofile pinterest
https://daily-harvest.com/collections/bites
Healthy Vegan Energy Bites | Daily Harvest
These portable superfood snacks are ready to meet any craving. Pop a bite whenever you need a satisfying, energizing snack or a just-right dessert.
healthy veganenergy bitesdaily harvest
https://www.veganrecipeclub.org.uk/recipes/healthy-recipes-vegan/
97+ Healthy Vegan Recipes - Vegan Recipe Club
Mar 7, 2023 - Hundreds of tried and tested vegan recipes, with product tips and news! We’ve got convenience-style supermarket meals and beginner recipes, right up to...
healthy vegan recipes97club
https://www.onegreenplanet.org/vegan-food/healthy-vegan-omega-3-rich-recipes/
10 Healthy Vegan Omega 3-Rich Recipes – One Green Planet
Sep 26, 2017 - Lucky for us, plant-based foods are packed with omega-3 fats, so eat up as many of them as you can so you can get the benefits. Here are 10 recipes to get you...
one green planet10 healthyomega 3veganrich
https://thevegan8.com/vegan-butterfinger-candy-bars/
Healthy Vegan Butterfinger Candy Bars
healthy vegancandy barsbutterfinger
https://wholenewmom.com/healthy-chocolate-almond-joy-home-made-candy/
Sugar-Free Keto Almond Joy Bars—No Bake, Healthy, Vegan
Mar 7, 2026 - This keto Sugar-free Almond Joy recipe is easy to make, low carb, and deliciously satisfying with chocolate, coconut, and almonds.
sugar free ketohealthy veganalmondjoybake
https://www.myplantifulcooking.com/healthy-sweet-treats/
Healthy Vegan Dessert Recipes – My Plantiful Cooking
Satisfy your sweet tooth with our indulgent yet light and healthy vegan dessert recipes made from wholesome ingredients.
vegan dessert recipesplantiful cookinghealthy
https://veggiekinsblog.com/
Veggiekins by Remy Park | Healthy Vegan Recipes & Wellness
Jun 23, 2023 - Welcome to Veggiekins Blog, home to nourishing vegan + gluten-free recipes and tips to live your best balanced and holistic life. I’m a human on a mission to...
healthy vegan recipesveggiekinsremyparkwellness
https://choosingchia.com/category/diet/vegan/
Easy and Healthy Vegan Recipes - Choosing Chia
Looking for easy and healthy vegan recipes? From vibrant breakfasts to hearty mains and sweet plant-based treats, these recipes are full of flavor and perfect...
healthy vegan recipeschoosing chiaeasy
https://vancouverwithlove.com/
Vancouver with Love | Healthy vegan recipes and lifestyle.
Jan 24, 2024 - Welcome to Vancouver with Love. Sharing delicious vegan recipes that are gluten-free and refined sugar-free, as well as plant-based guides and travel.
healthy vegan recipesvancouverlovelifestyle
https://www.diannesvegankitchen.com/
Healthy Vegan Recipes – Dianne's Vegan Kitchen
Apr 1, 2026 - Dianne's Vegan Kitchen is home to all things vegan! Here you'll find healthy vegan recipes and healthy plant-based living tips.
healthy vegan recipesdiannekitchen
https://happyfoodhealthylife.com/
Delicious Healthy Vegan Recipes for the Whole Family - Happy Food, Healthy Life
Aug 14, 2025 - Breakfast Dinners Desserts Sides Nourish to flourish—happy foods make for a happy life. Breakfast Main Dish Side Dishes Dessert Drinks Snacks + Apps All the...
healthy vegan recipeswhole familyfood lifedelicioushappy
https://dietitiandebbie.com/
Healthy Vegan & Vegetarian Recipes | Dietitian Debbie Dishes
Feb 19, 2025 - Dietitian Debbie Dishes is a healthy living blog where you'll find tasty vegetarian recipes and helpful nutrition tips.
healthy vegan vegetariandietitian debbie dishesrecipes
https://nutritioninthekitch.com/8-simple-overnight-oats-with-frozen-fruit/
8 Simple Overnight Oats With Frozen Fruit | easy, healthy, vegan!
This list of gluten free and vegan overnight oats with frozen fruit will show you how easy eating a healthy breakfast can be in the mornings!
8 simpleovernight oatsfrozen fruiteasy healthyvegan
https://healthyvoyager.com/
The Healthy Voyager - International Travel and Vegan Recipe Blog
Your one stop shop for international travel via informative posts and tips for healthy, adventure, luxury, wellness, culinary and sustainable travel as well as...
healthy voyagerinternational travelvegan recipeblog
https://exsloth.com/
Easy Vegan Recipes and Healthy Living Tips - Diary of an ExSloth
Nov 4, 2016 - Canada based blogger sharing easy vegan recipes, perfect for lazy girls everywhere, plus simple tips for healthy eating and creating a healthy lifestyle.
easy vegan recipeshealthy living tipsdiary
https://orderavo.com/midtown-east
Avo Midtown East | Healthy Salads & Bowls | Vegan Restaurant | Avo — Avo
midtown easthealthy saladsvegan restaurantavobowls
https://www.vegansociety.com/go-vegan/why-go-vegan/health
Why Go Vegan | Being Healthy on a Vegan Diet | Vegan health
Eating a diet that supports excellent health, helps animals and protects the planet
go vegandiet healthhealthy
https://www.skinnytaste.com/recipes/vegan/
Easy Vegan Recipes | Healthy Plant Based and Vegan Meals
These healthy vegan recipes and plant-based meals are nutritious, delicious, and guaranteed to satisfy, from vegan breakfast ideas to meatless dinners.
easy vegan recipeshealthy plant basedmeals
https://vegangela.com/
Vegan Recipes — Quick, Easy & Healthy! | Vegangela
quick easy healthyvegan recipesvegangela
https://healthyvoyager.com/budget-friendly-vegan-living-in-a-time-of-rising-food-costs/
Budget-Friendly Vegan Living in a Time of Rising Food Costs - The Healthy Voyager
Apr 9, 2026 - In light of the consistent increase in food prices, embracing a vegan lifestyle can be both economically wise and environmentally friendly. With the surge in...
budget friendlyvegan livingrising foodhealthy voyagertime
https://allergyawesomeness.com/double-chocolate-muffins-gf-df-egg-soy-peanuttree-nut-free-top-8-free-vegan/
Healthy Gluten-Free Vegan Double Chocolate Muffins
Dec 20, 2025 - Rich, moist double chocolate muffins made gluten-free, vegan, and free from the top 8 allergens—perfect for breakfast or snacking.
healthy gluten freedouble chocolate muffinsvegan
https://airkitchen.me/kitchen/2801.php
Healthy Ramen & Gyoza (halal/vegan/gluten free acceptable) | Osaka Cooking Class | airKitchen
vegan gluten freecooking classhealthyramengyoza
https://www.thehealthy.com/food/recipes/vegan-recipes-meal-ideas/
12 Delicious Vegan Recipes for Breakfast, Lunch, and Dinner | The Healthy
Jan 11, 2023 - Food experts share their delicious vegan recipes for breakfast, lunch, and dinner to show you how easy—and delicious—a vegan diet can be.
delicious vegan recipesbreakfast lunch12dinnerhealthy
https://elavegan.com/
Elavegan - Simple, healthy, and delicious vegan recipes
Vegan recipes from Michaela Vais, author of the Simple and Delicious Vegan Cookbook. Includes gluten-free, healthy, and plant-based recipes.
delicious vegan recipessimple healthyelavegan
https://www.simplyquinoa.com/category/recipes/dessert/
Dessert Recipes | Healthy, Easy Gluten-Free and Vegan Desserts
Indulge (guilt-free!) in our best healthy dessert recipes! These easy desserts are 100% gluten-free and dairy-free, with vegan recipes, too.
recipes healthy easygluten freevegan desserts
https://www.urthbox.com/
Healthy Snack Subscription Box | Gluten-Free, Vegan & Keto Snack Boxes – UrthBox
UrthBox is the ultimate healthy snack box delivery service filled with GMO-free and organic snacks and goodies perfect for the home or office.
gluten free veganhealthy snacksubscription boxketoboxes
https://www.realfoodforlife.com/vegan-recipes/breakfast/
Vegan Breakfast Recipes, a Healthy Start to Your Day
vegan breakfast recipeshealthy startday
https://www.amny.com/lifestyle/eat-and-drink/healthy-as-a-motha-woman-behind-vegan-brooklyn-business/
Healthy as a Motha: The woman behind a booming vegan Brooklyn business | amNewYork
Mar 12, 2026 - Ramdass now finds herself as the co-owner, founder and chef at Healthy as a Motha, otherwise known as HAAM.
woman behindbrooklyn businesshealthymothabooming
https://wildearth.com/
Wild Earth Pet Food: Vegan Nutrition for Healthy Dogs & Cats
Discover Wild Earth, a leading vegan pet food brand as seen on Shark Tank. Give your pets the nutrition they deserve with clean, plant-based ingredients for...
wild earthpet foodvegan nutritionhealthy dogscats
https://www.webmd.com/food-recipes/vegetarian-and-vegan-diet
Vegetarian Diets: Vegan, Lacto-Vegetarian, Ovo-Vegetarian, Healthy, and Balanced Diet
WebMD explains various vegetarian and vegan diets, along with the nutritional requirements of following these diets.
vegetarian dietsveganlactoovohealthy
https://www.mosaicfoods.com/pages/vegan-meal-delivery
Vegan Meal Delivery - Healthy, Plant-based Meals, Delivered | Mosaic
Healthy and satisfying vegan meals, delivered. We source fresh local produce and hand-cook our meals to perfection, then deliver straight to you. Check out our...
vegan meal deliveryhealthy plant basedmeals deliveredmosaic
https://www.theblendergirl.com/
The Blender Girl - Easy Healthy Recipes {Vegan + Gluten-Free}
May 14, 2020 - The Blender Girl shares easy healthy recipes that are all vegan and gluten-free, and use whole natural ingredients. Use your blender to make amazing dishes.
easy healthy recipesvegan gluten freeblendergirl
https://forums.justusboys.com/threads/favorite-healthy-vegetarian-and-or-vegan-meals.336181/
Favorite Healthy Vegetarian And/or Vegan Meals | JustUsBoys The World's Largest Gay Message Board
I thought it would be fun and helpful to have a thread for healthy vegetarian and/or vegan meals. Here is a recipe that Transpogue (sp?) has done...
largest gay messagehealthy vegetarianvegan mealsfavoritejustusboys
https://runningonrealfood.com/category/recipes/vegan-soup-recipes/
Vegan Soup Recipes (Easy, Healthy & Meal-Prep Friendly)
Healthy vegan soup recipes made with simple ingredients. Easy, cozy plant-based soups perfect for weeknight dinners, meal prep, and freezing.
recipes easy healthymeal prep friendlyvegansoup
https://www.quorn.us/products/healthy-options
Vegan & Vegetarian Healthy Meal Options | Quorn
Discover our healthy product options from Quorn. Low saturated fat and high in protein, perfect for making healthy meals taste great. Click to view our range.
vegan vegetarianhealthy mealoptionsquorn
https://www.vegparadise.com/
VegParadise | Vegan Recipes, Reviews & Healthy Swaps
Apr 7, 2026 - Explore vegan recipes, food reviews, and healthy meat-free swaps. VegParadise is your go-to blog for low-carb, low-fat plant-based inspiration.
vegan recipesreviews healthyvegparadiseswaps
https://www.plantarestaurants.com/
Vegan Sushi, Vegan Food & Healthy Vegan Eats | PLANTA
Vegan sushi, vegan food, and healthy vegan meals. Crave-worthy, fresh, and 100% vegan. Order online or dine in at PLANTA for delicious vegan eats.
vegan sushifood healthyeatsplanta
https://biancazapatka.com/en/my-cookbooks/
My Cookbooks - Vegan Cooking and Baking Recipes - Bianca Zapatka | healthy vegan & vegetarian...
recipes bianca zapatkavegan cookinghealthy vegetariancookbooksbaking
https://www.woktowalk.com/
Wok to Walk: Custom made healthy, fast food. Vegan and vegetarian options. Delicious Asian dishes...
Dec 4, 2025 - Make your own Asian recipe and we cook it your way with the freshest ingredients. Find the nearest restaurant, check our menu and nutrition calculator here.
healthy fast foodcustom madedelicious asianwokwalk
https://health.clevelandclinic.org/is-a-vegan-diet-healthy
Is a Vegan Diet Healthy?
A vegan diet that eliminates animal products can be healthy, but only if you get certain nutrients like protein, calcium and vitamin B12 from other sources.
vegan diethealthy
https://downshiftology.com/recipes/spinach-and-artichoke-dip-dairy-free-paleo/
Healthy Spinach Artichoke Dip (Dairy-Free & Vegan) | Downshiftology
Jan 30, 2026 - This dairy-free, paleo-friendly spinach and artichoke dip is creamy, flavorful, easy-to-make and sure to be a crowd favorite.
spinach artichoke dipdairy free veganhealthydownshiftology
https://formnutrition.com/product-category/vegan-protein-powder/
Vegan Protein Powder, Perfect Post Workout or Healthy Snack | By Form®
The highest rated ⭐ best tasting 😋 vegan protein powder around 💪 Naturally advanced plant-based nutrition 🛒 Shop the range with next day delivery 🎁
vegan protein powderperfect posthealthy snackworkout
https://thishealthykitchen.com/vegan-chocolate-chip-cookies/
Vegan Chocolate Chip Cookies [GF] - This Healthy Kitchen
May 16, 2023 - Healthy vegan chocolate chip cookies that are soft and fluffy, lightly sweetened, and incredibly delicious. Plus, they're gluten free, nut free and oil free,...
vegan chocolate chiphealthy kitchencookiesgf
https://www.veganfamilyrecipes.com/healthy-potato-pea-soup/
Healthy Potato Pea Soup - Vegan Family Recipes
pea soup veganhealthy potatofamily recipes
https://simple-veganista.com/recipes/course/dinner/easy-weeknight-dinner-recipes/
Easy Vegan Weeknight Dinners: Quick, Healthy Recipes in 30 Minutes or Less
Easy vegan weeknight dinners ready in 30 minutes or less! Quick, healthy, plant-based recipes like one-pan meals, hearty bowls, and simple pastas for busy...
quick healthy recipeseasy veganweeknight dinners30 minutesless
https://www.hindustantimes.com/lifestyle/recipe/tofu-bhurji-recipe-healthy-high-protein-vegan-breakfast-made-with-tofu-herbs-and-vegetables-101776921526337.html
Tofu Bhurji Recipe: Healthy High-Protein Vegan Breakfast Made With Tofu, Herbs, and Vegetables |...
Apr 23, 2026 - Tofu Bhurji is a quick, high-protein vegan breakfast made with crumbled tofu, vegetables, and Indian spices.
healthy high proteinvegan breakfasttofurecipemade
https://www.urthbox.com/?tid=1026&coupon_codes=HOLIDAYPROMO&sv1=affiliate&sv_campaign_id=2079267&tid=1026&coupon_codes=promo10&sscid=88563_1775508797_2853ea5b73067b01862ac68ccbc9e5a2&awc=88563_1775508797_2853ea5b73067b01862ac68ccbc9e5a2
Healthy Snack Subscription Box | Gluten-Free, Vegan & Keto Snack Boxes – UrthBox
UrthBox is the ultimate healthy snack box delivery service filled with GMO-free and organic snacks and goodies perfect for the home or office.
gluten free veganhealthy snacksubscription boxketoboxes
https://healthylittlevittles.com/
Healthy Little Vittles | Gluten-free, Vegan & Plant-based Recipes
Mar 5, 2026 - Healthy Little Vittles is your go-to destination for delicious gluten-free, vegan, and plant-based recipes designed to nourish and inspire. From no-bake...
gluten free veganplant based recipeshealthy littlevittles
https://www.vegansociety.com/resources/nutrition-and-health
Vegan Living | How to be healthy on a vegan diet
Expert tips for making the most of your vegan diet
vegan livinghealthydiet