https://thebettertech.io/podcast/the-hidden-risks-of-affective-ai/
The Hidden Risks of Affective AI - Better Tech
In this episode of BetterTech, host Jocelyn Byrne Houle talks about the hidden risk of affective ai with Ana Catarina De Alencar, Resident Philosopher at the
hidden risksai betteraffectivetech
https://www.kudelskilabs.com/newsroom/keeping-the-lights-on-the-hidden-risks-of-ip-based-power-distribution
Keeping the Lights On: The Hidden Risks of IP-Based Power Distribution
hidden risksbased powerkeepinglightsip
https://www.lycetts.co.uk/insights/uncovering-the-hidden-risks-of-rewilding-and-biodiversity-projects/
Lycetts Uncovering the hidden risks of rewilding and biodiversity projects - Lycetts
Apr 16, 2026 - Across Scotland, rewilding and biodiversity-led land management are moving into mainstream land management, often with a dual aim of ecological recovery and
hidden riskslycettsuncoveringrewildingbiodiversity
https://www.thebitcoinway.com/articles/the-hidden-risks-of-bitcoin
The Hidden Risks of Bitcoin Collaborative Custody
Feb 12, 2025 - Is collaborative custody a safer Bitcoin option? Discover its risks and why full self-custody is the true way forward.
hidden risksbitcoincollaborativecustody
https://electrichome.uk/content/sustainable-homes-must-also-be-safe-help-for-seniors-warns-on-hidden-risks-in-green-retrofits/
Sustainable Homes Must Also Be Safe: Help for Seniors Warns on Hidden Risks in Green Retrofits -...
The drive to decarbonise Britain’s housing stock is transforming how many older people live, with solar panels, heat pumps and high‑performance insulation now...
sustainable homeshidden risksmustalsosafe
https://cyberscoop.com/ai-healthcare-apps-hipaa-privacy-risks-openai-anthropic/
Why your AI doctor doesn't follow HIPAA: The hidden risks of medical chatbots | CyberScoop
Feb 11, 2026 - Are AI health apps like ChatGPT and Claude HIPAA compliant? Experts warn of significant data privacy risks as tech giants expand into healthcare without the...
ai doctorhidden risksfollowhipaamedical
https://getfailsafe.com/the-hidden-risks-of-multisig-wallets-lessons-from-bybit-0xinfini-and-how-to-stay-secure
FailSafe: The Hidden Risks of Multisig Wallets: Lessons from Bybit, 0xInfini, and How to Stay Secure
Feb 24, 2025 - Multisig Security in the Spotlight In recent months, the security of multisig wallets has come under intense scrutiny as high-profile breaches continue to expos
hidden risksfailsafemultisigwalletslessons
https://mlsecops.com/podcast/from-pickle-files-to-polyglots-hidden-risks-in-ai-supply-chains
From Pickle Files to Polyglots: Hidden Risks in AI Supply Chains
Apr 2, 2025 - Explore the hidden risks in AI supply chains, from jailbreaks and prompt injection to backdoored models and insecure dependencies.
hidden risksai supplypicklefilespolyglots
https://otnexus.com/the-hidden-risks-in-every-ot-change-why-formal-change-management-is-a-cybersecurity-must/
The Hidden Risks in OT Change Management | Why Formal Processes Protect ICS
Untracked OT changes can trigger downtime, compliance gaps, and security risks. Discover why formal change management is critical in ICS and how OTNexus...
hidden riskschange managementotformalprocesses
https://www.mordorintelligence.com/signal/insights/ai-only-market-research-risks
The Hidden Risks of AI-Generated Market Research | Mordor Intelligence Insights
Jul 23, 2025 - AI-generated research can be misleading, know why expert validation, context, and data traceability are critical for high-stakes B2B decisions.
hidden risksai generatedmarket researchmordorintelligence
https://www.finos.org/hidden-risks-of-not-contributing-case-study
Hidden Risks of Not Contributing Case Study Sign Up Page
Open source software underpins most technology in financial services, yet the industry is still maturing in how it manages and leverages this strategic...
hidden riskscase studycontributingsign
https://www.suvoda.com/insights/blog/technology-fragmentation-is-one-of-the-biggest-hidden-risks-in-clinical-trials
Technology fragmentation is one of the biggest hidden risks in clinical trials
Mar 26, 2026 - Technology fragmentation is one of the biggest hidden risks in clinical trials
hidden riskstechnologyfragmentationonebiggest
https://www.probackup.io/why-backup/the-hidden-risks-of-saas-data
The Hidden Risks of SaaS Data Loss (and How to Prevent It) | ProBackup
Human error, departing employees, faulty integrations, and AI agents all put your SaaS data at risk. Here's what your provider won't protect — and how to...
hidden riskssaas datalosspreventprobackup
https://www.chemaqua.com/en-us/blog/2025/12/04/balancing-the-hidden-risks-in-cooling-tower-equalizer-lines/
Balancing the Hidden Risks in Cooling Tower Equalizer Lines | Chem-Aqua
Dec 17, 2025 - Discover the hidden risks of cooling tower equalizer lines and learn best practices for design, maintenance, and water treatment to ensure balanced, efficient,...
hidden riskscooling towerbalancingequalizerlines
https://internationalsecurityjournal.com/hidden-risks-customer-facing-ai/
60 seconds to crisis: the hidden risks of customer-facing AI
May 6, 2026 - Picture this: a customer contacts your AI chatbot at 11 PM about a refund.
hidden riskscustomer facingsecondscrisisai
https://www.metomic.io/resource-centre/data-security-in-the-ai-age
Data Security in the AI Age: The Hidden Risks of Enterprise AI Tools and How CISOs Can Protect...
Metomic's report analyzes six major AI tools: ChatGPT, NotionAI, Glean, Microsoft 365 Copilot, Google Gemini, and Dust AI, revealing how enterprise AI adoption...
data securityai agehidden risksenterprisetools
https://indyschoolconsultancy.com/news-store/the-hidden-risks-in-leadership-recruitment
The Hidden Risks in Leadership Recruitmentbr/ — IndySchool Consultancy
Apr 9, 2026 - In leadership hiring, schools often focus on résumés, interviews, and references. While those matter, the greatest risks in recruitment are often less visible.
hidden risksleadershipconsultancy
https://www.cisoforum.com/event-session/beneath-the-prompt-the-hidden-risks-powering-genai/
Beneath the Prompt: The Hidden Risks Powering GenAI | CISO Forum
As LLMs power more applications across industries, firmware and hardware security is now mission-critical. The attack surface has shifted downward, making AI...
hidden risksbeneathpromptpoweringgenai
https://www.wecf.org/event-recap-women-and-chemicals-everyday-exposure-hidden-risks-and-the-fight-for-a-toxic-free-future/
Event Recap: Women and Chemicals — Everyday Exposure, Hidden Risks, and the Fight for a Toxic-Free...
event recaphidden riskswomenchemicalseveryday
https://www.responsiblegambling.or.ke/blog/gambling-social-media-risks-influences
Gambling and Social Media: Hidden Risks and Influences | Responsible Gambling Kenya
Discover how social media platforms influence gambling behavior. Learn about hidden advertising, social proof effects, and protecting yourself online.
social mediahidden risksgamblinginfluencesresponsible
https://www.barodabnpparibasmf.in/blogs/hidden-risks-of-low-risk-investments
Hidden Risks of “Low Risk” Investments
Baroda BNP Paribas Mutual blog
hidden risksinvestments
https://www.wecf.org/event/webinar-women-and-chemicals-everyday-exposure-hidden-risks-and-the-fight-for-a-toxic-free-future/
Webinar: Women and chemicals: everyday exposure, hidden risks and the fight for a toxic-free future...
Mar 12, 2026 - What is really in the products we use every day? Pesticides and chemicals shape our daily lives in ways we… Continue Reading Webinar: Women and chemicals:...
hidden riskstoxic freewebinarwomenchemicals
https://techtalksnetwork.com/podcast/tech-talks-daily/episode/inside-eys-2026-tech-pulse-poll-the-hidden-risks-of-ai-adoption
Inside EY's 2026 Tech Pulse Poll The Hidden Risks Of AI Adoption | The Tech Talks Network |...
I sit down with Ken Englund from EY to unpack findings from the latest 2026 Technology Pulse Poll,
hidden risksai adoptioninsideeytech
https://beatcolor.com/blog/photo-video-editing/the-dark-side-of-virtual-staging-in-real-estate-nobody-talks-about/
Virtual Staging in Real Estate: Hidden Risks Nobody Talks About
Apr 11, 2026 - Discover overlooked risks of virtual staging in real estate and how misuse can damage trust, pricing, and buyer decisions.
virtual stagingreal estatehidden risksnobody talks
https://www.avetta.com/blog/dodging-the-bullet-hidden-risks-in-your-supply-chain-that-you-cant-ignore
Dodging the Bullet: Hidden Risks in Your Supply Chain that You Can't Ignore | Avetta
Uncover the hidden risks lurking within your supply chain and protect your business against potential disruptions.
hidden riskssupply chaindodgingbulletignore
https://www.hlbsom.com/hidden-risks-in-cyber-defence-laying-a-foundation-for-effective-cybersecurity-risk-mitigation/
Hidden risks in cyber-defence: laying a foundation for effective cybersecurity risk mitigation |...
Jul 5, 2023 - Hidden risks in cyber-defence: laying a foundation for effective cybersecurity risk mitigation 31 March 2022 Cybersecurity has become an important issue for...
hidden riskscyber defencelayingfoundationeffective
https://linuxblog.io/insider-threat-awareness-unveiling-hidden-risks/
Sept 2023: Insider Threat Awareness Month - Unveiling Hidden Risks | LinuxBlog.io
Nov 11, 2024 - In the realm of cybersecurity, vigilance is key. Threats can come from anywhere, and sometimes, they emerge from within. In September 2023, we observe
insider threatawareness monthhidden risksseptunveiling
https://compliancepodcastnetwork.net/category/uncovering-hidden-risks/
Uncovering Hidden Risks Archives - Compliance Podcast Network
Uncovering Hidden Risks
archives compliance podcastuncovering hiddenrisksnetwork
https://web.integritynext.com/resources/whitepaper/unmasking-forced-labor-managing-hidden-risks-in-global-supply-chains
IntegrityNext White Paper - Unmasking Forced Labor – Managing Hidden Risks in Global Supply Chains
white paperforced laborhidden risksglobal supplyintegritynext
https://www.whlwell.com/en/news/20250323083657f40d1c
"Hidden Risks of Frozen Food: Experts Reveal How to Identify Bacterial Growth and Prevent Foodborne...
This article reveals the potential health risks of frozen foods and emphasizes the importance of proper handling and identifying potential bacterial hazards....
hidden risksfrozen foodexperts revealidentifybacterial
https://relminsurance.com/risk-wrap-043-developer-liability-deepfakes-cannabis-law-hidden-ai-risks-agentic-crypto-control-and-ai-gambling-monitoring/
Risk Wrap 043: Developer Liability, Deepfakes, Cannabis Law, Hidden AI Risks, Agentic Crypto...
Mar 16, 2026 - Insights on blockchain developer liability, deepfake laws, cannabis regulation, hidden AI risks, agentic crypto, and AI gambling oversight.
risk wrapcannabis lawai risksdeveloperliability
https://www.databreachtoday.asia/webinars/webinar-hidden-identity-risks-ai-agents-w-7057?rf=training
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
. data security breach
hidden identity riskswebinarai
https://www.worklife.news/leadership/wtf-is-quiet-cracking/
This hidden form of burnout risks billions in lost productivity
Sep 16, 2025 - Unlike quiet quitting — where employees deliberately dial down effort — quiet cracking is an involuntary mental breakdown.
hiddenformburnoutrisksbillions
https://www.hiddenlayer.com/insight/agents
Hidden Risk of Agentic AI: Risks Beyond Prompts
Explore HiddenLayer Agents and learn how AI agents operate, interact, and introduce new security risks in autonomous AI systems.
hidden riskagentic airisksbeyondprompts
https://ilkari.tech/services/domain-name-services/digital-intelligence/
Digital Intelligence Services | Protect Against Hidden Risks
digital intelligenceservices protecthiddenrisks
https://thefishsite.com/articles/researchers-uncover-hidden-toxin-risks-in-nutrient-starved-algal-blooms
Researchers uncover hidden toxin risks in nutrient-starved algal blooms | The Fish Site
Feb 2, 2026 - New research from Incheon National University reveals that algal blooms can become significantly more toxic even after their growth has stabilised.
uncover hiddenresearcherstoxinrisksnutrient
https://www.uvcyber.com/resources/reports/quarterly-threat-report-ot-ics-hidden-equipment-with-quiet-risks-q3-2025
Quarterly Threat Report: OT\ICS: Hidden Equipment with Quiet Risks - Q3 2025
Nov 13, 2025 - This in-depth quarterly report uncovers how the convergence of operational technology and IT networks is exposing critical infrastructure systems—like access...
threat reportot icsquarterlyhiddenequipment
https://www.healthcareinfosecurity.com/webinars/webinar-hidden-identity-risks-ai-agents-w-7055?rf=training
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
. healthcare information security
hidden identity riskswebinarai
https://www.bankinfosecurity.com/webinars/webinar-hidden-identity-risks-ai-agents-w-7057?rf=training
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
. bank information security
hidden identity riskswebinarai
https://haderslevwiki.dk/index.php/AI_Profile_Pictures:_The_Hidden_Benefits_And_Critical_Risks_For_Professional_Branding
AI Profile Pictures: The Hidden Benefits And Critical Risks For Professional Branding -...
ai profilehidden benefitspicturescriticalrisks
https://sogevity.com/toxic-relations-invisible-danger/
Toxic relationships and ageing: hidden health risks
Discover how toxic relationships may accelerate biological ageing, increase stress and inflammation, and affect long-term mental and physical health.
toxic relationshipsageinghiddenhealthrisks
https://www.plusbase.com/feature/ecommerce-hosting
The Perfect Ecommerce Hosting Solution, No Hidden Risks
Super-charge your business with our comprehensive eCommerce web hosting, including: SSL certificate, unlimited bandwidth, secure shopping cart, and more!
ecommerce hostingperfectsolutionhiddenrisks
https://www.paymentsecurity.io/webinars/webinar-hidden-identity-risks-ai-agents-w-7055?rf=training
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
hidden identity riskswebinarai
https://www.healthcareinfosecurity.com/webinars/webinar-hidden-identity-risks-ai-agents-w-7055
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
. healthcare information security
hidden identity riskswebinarai
https://www.databreachtoday.asia/webinars/webinar-hidden-identity-risks-ai-agents-w-7057
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
. data security breach
hidden identity riskswebinarai
https://www.govinfosecurity.com/webinars/webinar-hidden-identity-risks-ai-agents-w-7055
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
. government information security
hidden identity riskswebinarai
https://www.devicesecurity.io/webinars/webinar-hidden-identity-risks-ai-agents-w-7055
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
hidden identity riskswebinarai
https://www.eurohomecare.com/identifying-hidden-safety-risks-in-older-homes-before-incidents-occur
Identifying Hidden Home Safety Risks for Seniors
May 28, 2026 - Discover common hidden safety risks in older homes and how home care support can help seniors stay safe without major renovations.
safety risksidentifyinghiddenseniors
https://kjp-plumbing-southampton.co.uk/moldleaks
The Hidden Health Risks in Your Tap: How Plumbing Issues Can Affect Women’s Health
Discover how plumbing issues like bacteria, leaks and poor water quality can impact women’s health, and what to check in your home to stay safe.
health riskshiddentapplumbingissues
https://www.businessblogs.sg/the-ultimate-guide-to-mold-removal-in-singapore-protecting-your-home-from-hidden-health-risks/
The Ultimate Guide to Mold Removal in Singapore: Protecting Your Home from Hidden Health Risks -...
The Ultimate Guide to Mold Removal in Singapore: Protecting Your Home from Hidden Health Risks Singapore’s tropical climate brings warmth, greenery, and...
ultimate guidemold removalsingaporeprotectinghidden
https://AllTradesJournal.com/automotive-services/australian-fuel-pump-market-risks
Australian Fuel Pump Market: Booming Sales, Hidden Safety Risks | AllTradesJournal
May 8, 2026 - Up to 12% of automotive fuel transfer pumps listed online in Australia fail basic safety checks, posing a significant risk to drivers.
fuel pumpsafety risksaustralianmarketbooming
https://aurawordss.com/hidden-everyday-risks-for-aging-adults-and-how-to-prevent-them/
Hidden Everyday Risks for Aging Adults and How to Prevent Them - Aura Wordss
Mar 31, 2026 - Life in later years brings comfort, wisdom, and meaningful experiences. At the same time, daily routines can come with small but important safety challenges.
hiddeneverydayrisksagingadults
https://www.ot.today/webinars/webinar-hidden-identity-risks-ai-agents-w-7055
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
hidden identity riskswebinarai
https://www.cuinfosecurity.com/webinars/webinar-hidden-identity-risks-ai-agents-w-7055
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
. credit unions information security
hidden identity riskswebinarai
https://mlsecops.com/podcast/ai-security-vulnerability-detection-and-hidden-risks-in-model-files
AI Security: Vulnerability Detection and Hidden Model File Risks
Dec 9, 2024 - Explore model file vulnerabilities, the evolution of AI security, and how MLSecOps and tools like huntr drive proactive protection in AI pipelines.
ai securityvulnerability detectionhiddenmodelfile
https://www.channelnewsasia.com/watch/doctors-warn-hidden-cancer-risks-caution-against-excessive-or-unproven-tests-6082176
Doctors warn of hidden cancer risks but caution against excessive or unproven tests - CNA
Apr 26, 2026 - Doctors are urging the public to seek medical advice when abnormal symptoms arise, following the death of local marathoner Eugene Lim. Despite early warning...
doctorswarnhiddencancerrisks
https://www.seymourtelegraph.com.au/news/lithium-ion-batteries-in-everyday-devices-pose-a-hidden-fire-risk-4/
Hidden fire risks in everyday devices | Seymour Telegraph
“Lithium-ion batteries have become part of everyday life, but many people still underestimate the fire risk.”
hiddenfireriskseverydaydevices
https://www.synchronous-science.co.uk/
Synchronous Science | Uncover Hidden Electromagnetic Risks
Sep 17, 2025 - Uncover hidden electromagnetic risks and act with clarity. Synchronous Science helps defence and security teams secure mission success.
uncover hiddensynchronousscienceelectromagneticrisks
https://www.govinfosecurity.com/webinars/webinar-hidden-identity-risks-ai-agents-w-7055?rf=training
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
. government information security
hidden identity riskswebinarai
https://www.bankinfosecurity.in/webinars/webinar-hidden-identity-risks-ai-agents-w-7057?rf=training
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
. bank information security
hidden identity riskswebinarai
https://thekyb.com/blog/adverse-media-screening-a-way-forward-to-uncover-hidden-business-risks/
Adverse Media Screening: A Way Forward to Uncover Hidden Business Risks
Oct 10, 2024 - Seeking solutions to safeguard your business against potential risks and negative media coverage? Adverse media screening can help you uncover business risks.
media screeningway forwarduncover hiddenadversebusiness
https://www.sciencealert.com/hidden-mental-health-risks-of-perimenopause-identified-for-first-time
Hidden Mental Health Risks of Perimenopause Identified For First Time : ScienceAlert
Women going through perimenopause – the transition period surrounding the menopause – are more than twice as likely to develop bipolar disorder for the first...
mental healthfirst timehiddenrisksperimenopause
https://www.databreachtoday.eu/webinars/webinar-hidden-identity-risks-ai-agents-w-7057?rf=training
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
. data security breach
hidden identity riskswebinarai
https://www.fraudtoday.io/webinars/webinar-hidden-identity-risks-ai-agents-w-7055?rf=training
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
hidden identity riskswebinarai
https://www.swecogroup.com/corporate-news/sweco-analysis-shows-the-challenge-posed-by-hidden-water-risks-to-europes-long-term-resilience/
Sweco Group - Sweco analysis shows the challenge posed by hidden water risks to Europe’s long‑term...
sweco groupanalysisshowschallengeposed
https://www.shenqiu123.com/sexual/1630.html
Throat Discomfort Unveiled: The Hidden Health Risks Behind Chronic Hoarseness Through Dual Lens of...
When a persistent hoarseness lingers beyond two weeks, it often serves as a silent alarm—not merely ...
health risksdual lensthroatdiscomfortunveiled
https://www.ot.today/webinars/webinar-hidden-identity-risks-ai-agents-w-7055?rf=training
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
hidden identity riskswebinarai
https://www.cxtoday.com/security-privacy-compliance/your-cx-stack-is-compliant-but-still-exposing-customer-data-at-every-interaction/
The Hidden Customer Data Risks Inside Your CX Stack
A passed audit doesn't protect customer data. See where CX stacks expose sensitive data - and how to close the gaps now.
customer datahiddenrisksinsidecx
https://wunwun.com/travel-tips/hidden-injury-risks-in-popular-tourist-attractions/
Hidden Injury Risks in Popular Tourist Attractions - Wun Wun
Mar 5, 2026 - Travel is meant to be exciting, relaxing, and full of memorable experiences. From bustling city centers to iconic entertainment hubs, tourist attractions are...
popular touristhiddeninjuryrisksattractions
https://www.vilofoss.com/News/MYCOSAFE-Protection-against-hidden-mycotoxin-risks
MYCOSAFE™: Protection against hidden mycotoxin risks - Vilofoss International
MYCOSAFE: Protection against hidden mycotoxin risks
protectionhiddenmycotoxinrisksvilofoss
https://www.devicesecurity.io/webinars/webinar-hidden-identity-risks-ai-agents-w-7055?rf=training
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
hidden identity riskswebinarai
https://fitweb.me/the-hidden-cybersecurity-risks-of-gacor-slot-link-aggregators/
The Hidden Cybersecurity Risks of Gacor Slot Link Aggregators - FitWeb
The allure of a “slot gacor” or a supposedly “hot” slot machine is a powerful draw for online gamblers. Platforms like BASKET168, which aggregate links to such...
cybersecurity risksgacor slothiddenaggregatorsfitweb
https://aiuse.blog/ai-wearables-medical-data-hidden-privacy-risks/
AI Wearables And Medical Data: Hidden Privacy Risks
Feb 12, 2026 - AI wearables in healthcare: understand medical data risks, GDPR duties, and clear privacy criteria to choose safer devices for long‑term health monitoring.
ai wearablesmedical datahiddenprivacyrisks
https://www.cuinfosecurity.com/webinars/webinar-hidden-identity-risks-ai-agents-w-7055?rf=training
Webinar | The Hidden Identity Risks of AI AgentsWebinar.
. credit unions information security
hidden identity riskswebinarai
https://www.ndss-symposium.org/ndss-paper/demystifying-rpki-invalid-prefixes-hidden-causes-and-security-risks/
Demystifying RPKI-Invalid Prefixes: Hidden Causes and Security Risks - NDSS Symposium
security risksdemystifyingrpkiinvalidprefixes