Robuta

https://thebettertech.io/podcast/the-hidden-risks-of-affective-ai/ The Hidden Risks of Affective AI - Better Tech In this episode of BetterTech, host Jocelyn Byrne Houle talks about the hidden risk of affective ai with Ana Catarina De Alencar, Resident Philosopher at the hidden risksai betteraffectivetech https://www.kudelskilabs.com/newsroom/keeping-the-lights-on-the-hidden-risks-of-ip-based-power-distribution Keeping the Lights On: The Hidden Risks of IP-Based Power Distribution hidden risksbased powerkeepinglightsip https://www.lycetts.co.uk/insights/uncovering-the-hidden-risks-of-rewilding-and-biodiversity-projects/ Lycetts Uncovering the hidden risks of rewilding and biodiversity projects - Lycetts Apr 16, 2026 - Across Scotland, rewilding and biodiversity-led land management are moving into mainstream land management, often with a dual aim of ecological recovery and hidden riskslycettsuncoveringrewildingbiodiversity https://www.thebitcoinway.com/articles/the-hidden-risks-of-bitcoin The Hidden Risks of Bitcoin Collaborative Custody Feb 12, 2025 - Is collaborative custody a safer Bitcoin option? Discover its risks and why full self-custody is the true way forward. hidden risksbitcoincollaborativecustody https://electrichome.uk/content/sustainable-homes-must-also-be-safe-help-for-seniors-warns-on-hidden-risks-in-green-retrofits/ Sustainable Homes Must Also Be Safe: Help for Seniors Warns on Hidden Risks in Green Retrofits​ -... The drive to decarbonise Britain’s housing stock is transforming how many older people live, with solar panels, heat pumps and high‑performance insulation now... sustainable homeshidden risksmustalsosafe https://cyberscoop.com/ai-healthcare-apps-hipaa-privacy-risks-openai-anthropic/ Why your AI doctor doesn't follow HIPAA: The hidden risks of medical chatbots | CyberScoop Feb 11, 2026 - Are AI health apps like ChatGPT and Claude HIPAA compliant? Experts warn of significant data privacy risks as tech giants expand into healthcare without the... ai doctorhidden risksfollowhipaamedical https://getfailsafe.com/the-hidden-risks-of-multisig-wallets-lessons-from-bybit-0xinfini-and-how-to-stay-secure FailSafe: The Hidden Risks of Multisig Wallets: Lessons from Bybit, 0xInfini, and How to Stay Secure Feb 24, 2025 - Multisig Security in the Spotlight In recent months, the security of multisig wallets has come under intense scrutiny as high-profile breaches continue to expos hidden risksfailsafemultisigwalletslessons https://mlsecops.com/podcast/from-pickle-files-to-polyglots-hidden-risks-in-ai-supply-chains From Pickle Files to Polyglots: Hidden Risks in AI Supply Chains Apr 2, 2025 - Explore the hidden risks in AI supply chains, from jailbreaks and prompt injection to backdoored models and insecure dependencies. hidden risksai supplypicklefilespolyglots https://otnexus.com/the-hidden-risks-in-every-ot-change-why-formal-change-management-is-a-cybersecurity-must/ The Hidden Risks in OT Change Management | Why Formal Processes Protect ICS Untracked OT changes can trigger downtime, compliance gaps, and security risks. Discover why formal change management is critical in ICS and how OTNexus... hidden riskschange managementotformalprocesses https://www.mordorintelligence.com/signal/insights/ai-only-market-research-risks The Hidden Risks of AI-Generated Market Research | Mordor Intelligence Insights Jul 23, 2025 - AI-generated research can be misleading, know why expert validation, context, and data traceability are critical for high-stakes B2B decisions. hidden risksai generatedmarket researchmordorintelligence https://www.finos.org/hidden-risks-of-not-contributing-case-study Hidden Risks of Not Contributing Case Study Sign Up Page Open source software underpins most technology in financial services, yet the industry is still maturing in how it manages and leverages this strategic... hidden riskscase studycontributingsign https://www.suvoda.com/insights/blog/technology-fragmentation-is-one-of-the-biggest-hidden-risks-in-clinical-trials Technology fragmentation is one of the biggest hidden risks in clinical trials Mar 26, 2026 - Technology fragmentation is one of the biggest hidden risks in clinical trials hidden riskstechnologyfragmentationonebiggest https://www.probackup.io/why-backup/the-hidden-risks-of-saas-data The Hidden Risks of SaaS Data Loss (and How to Prevent It) | ProBackup Human error, departing employees, faulty integrations, and AI agents all put your SaaS data at risk. Here's what your provider won't protect — and how to... hidden riskssaas datalosspreventprobackup https://www.chemaqua.com/en-us/blog/2025/12/04/balancing-the-hidden-risks-in-cooling-tower-equalizer-lines/ Balancing the Hidden Risks in Cooling Tower Equalizer Lines | Chem-Aqua Dec 17, 2025 - Discover the hidden risks of cooling tower equalizer lines and learn best practices for design, maintenance, and water treatment to ensure balanced, efficient,... hidden riskscooling towerbalancingequalizerlines https://internationalsecurityjournal.com/hidden-risks-customer-facing-ai/ 60 seconds to crisis: the hidden risks of customer-facing AI May 6, 2026 - Picture this: a customer contacts your AI chatbot at 11 PM about a refund. hidden riskscustomer facingsecondscrisisai https://www.metomic.io/resource-centre/data-security-in-the-ai-age Data Security in the AI Age: The Hidden Risks of Enterprise AI Tools and How CISOs Can Protect... Metomic's report analyzes six major AI tools: ChatGPT, NotionAI, Glean, Microsoft 365 Copilot, Google Gemini, and Dust AI, revealing how enterprise AI adoption... data securityai agehidden risksenterprisetools https://indyschoolconsultancy.com/news-store/the-hidden-risks-in-leadership-recruitment The Hidden Risks in Leadership Recruitmentbr/ — IndySchool Consultancy Apr 9, 2026 - In leadership hiring, schools often focus on résumés, interviews, and references. While those matter, the greatest risks in recruitment are often less visible. hidden risksleadershipconsultancy https://www.cisoforum.com/event-session/beneath-the-prompt-the-hidden-risks-powering-genai/ Beneath the Prompt: The Hidden Risks Powering GenAI | CISO Forum As LLMs power more applications across industries, firmware and hardware security is now mission-critical. The attack surface has shifted downward, making AI... hidden risksbeneathpromptpoweringgenai https://www.wecf.org/event-recap-women-and-chemicals-everyday-exposure-hidden-risks-and-the-fight-for-a-toxic-free-future/ Event Recap: Women and Chemicals — Everyday Exposure, Hidden Risks, and the Fight for a Toxic-Free... event recaphidden riskswomenchemicalseveryday https://www.responsiblegambling.or.ke/blog/gambling-social-media-risks-influences Gambling and Social Media: Hidden Risks and Influences | Responsible Gambling Kenya Discover how social media platforms influence gambling behavior. Learn about hidden advertising, social proof effects, and protecting yourself online. social mediahidden risksgamblinginfluencesresponsible https://www.barodabnpparibasmf.in/blogs/hidden-risks-of-low-risk-investments Hidden Risks of “Low Risk” Investments Baroda BNP Paribas Mutual blog hidden risksinvestments https://www.wecf.org/event/webinar-women-and-chemicals-everyday-exposure-hidden-risks-and-the-fight-for-a-toxic-free-future/ Webinar: Women and chemicals: everyday exposure, hidden risks and the fight for a toxic-free future... Mar 12, 2026 - What is really in the products we use every day? Pesticides and chemicals shape our daily lives in ways we… Continue Reading Webinar: Women and chemicals:... hidden riskstoxic freewebinarwomenchemicals https://techtalksnetwork.com/podcast/tech-talks-daily/episode/inside-eys-2026-tech-pulse-poll-the-hidden-risks-of-ai-adoption Inside EY's 2026 Tech Pulse Poll The Hidden Risks Of AI Adoption | The Tech Talks Network |... I sit down with Ken Englund from EY to unpack findings from the latest 2026 Technology Pulse Poll, hidden risksai adoptioninsideeytech https://beatcolor.com/blog/photo-video-editing/the-dark-side-of-virtual-staging-in-real-estate-nobody-talks-about/ Virtual Staging in Real Estate: Hidden Risks Nobody Talks About Apr 11, 2026 - Discover overlooked risks of virtual staging in real estate and how misuse can damage trust, pricing, and buyer decisions. virtual stagingreal estatehidden risksnobody talks https://www.avetta.com/blog/dodging-the-bullet-hidden-risks-in-your-supply-chain-that-you-cant-ignore Dodging the Bullet: Hidden Risks in Your Supply Chain that You Can't Ignore | Avetta Uncover the hidden risks lurking within your supply chain and protect your business against potential disruptions. hidden riskssupply chaindodgingbulletignore https://www.hlbsom.com/hidden-risks-in-cyber-defence-laying-a-foundation-for-effective-cybersecurity-risk-mitigation/ Hidden risks in cyber-defence: laying a foundation for effective cybersecurity risk mitigation |... Jul 5, 2023 - Hidden risks in cyber-defence: laying a foundation for effective cybersecurity risk mitigation 31 March 2022 Cybersecurity has become an important issue for... hidden riskscyber defencelayingfoundationeffective https://linuxblog.io/insider-threat-awareness-unveiling-hidden-risks/ Sept 2023: Insider Threat Awareness Month - Unveiling Hidden Risks | LinuxBlog.io Nov 11, 2024 - In the realm of cybersecurity, vigilance is key. Threats can come from anywhere, and sometimes, they emerge from within. In September 2023, we observe insider threatawareness monthhidden risksseptunveiling https://compliancepodcastnetwork.net/category/uncovering-hidden-risks/ Uncovering Hidden Risks Archives - Compliance Podcast Network Uncovering Hidden Risks archives compliance podcastuncovering hiddenrisksnetwork https://web.integritynext.com/resources/whitepaper/unmasking-forced-labor-managing-hidden-risks-in-global-supply-chains IntegrityNext White Paper - Unmasking Forced Labor – Managing Hidden Risks in Global Supply Chains white paperforced laborhidden risksglobal supplyintegritynext https://www.whlwell.com/en/news/20250323083657f40d1c "Hidden Risks of Frozen Food: Experts Reveal How to Identify Bacterial Growth and Prevent Foodborne... This article reveals the potential health risks of frozen foods and emphasizes the importance of proper handling and identifying potential bacterial hazards.... hidden risksfrozen foodexperts revealidentifybacterial https://relminsurance.com/risk-wrap-043-developer-liability-deepfakes-cannabis-law-hidden-ai-risks-agentic-crypto-control-and-ai-gambling-monitoring/ Risk Wrap 043: Developer Liability, Deepfakes, Cannabis Law, Hidden AI Risks, Agentic Crypto... Mar 16, 2026 - Insights on blockchain developer liability, deepfake laws, cannabis regulation, hidden AI risks, agentic crypto, and AI gambling oversight. risk wrapcannabis lawai risksdeveloperliability https://www.databreachtoday.asia/webinars/webinar-hidden-identity-risks-ai-agents-w-7057?rf=training Webinar | The Hidden Identity Risks of AI AgentsWebinar. . data security breach hidden identity riskswebinarai https://www.worklife.news/leadership/wtf-is-quiet-cracking/ This hidden form of burnout risks billions in lost productivity Sep 16, 2025 - Unlike quiet quitting — where employees deliberately dial down effort — quiet cracking is an involuntary mental breakdown. hiddenformburnoutrisksbillions https://www.hiddenlayer.com/insight/agents Hidden Risk of Agentic AI: Risks Beyond Prompts Explore HiddenLayer Agents and learn how AI agents operate, interact, and introduce new security risks in autonomous AI systems. hidden riskagentic airisksbeyondprompts https://ilkari.tech/services/domain-name-services/digital-intelligence/ Digital Intelligence Services | Protect Against Hidden Risks digital intelligenceservices protecthiddenrisks https://thefishsite.com/articles/researchers-uncover-hidden-toxin-risks-in-nutrient-starved-algal-blooms Researchers uncover hidden toxin risks in nutrient-starved algal blooms | The Fish Site Feb 2, 2026 - New research from Incheon National University reveals that algal blooms can become significantly more toxic even after their growth has stabilised. uncover hiddenresearcherstoxinrisksnutrient https://www.uvcyber.com/resources/reports/quarterly-threat-report-ot-ics-hidden-equipment-with-quiet-risks-q3-2025 Quarterly Threat Report: OT\ICS: Hidden Equipment with Quiet Risks - Q3 2025 Nov 13, 2025 - This in-depth quarterly report uncovers how the convergence of operational technology and IT networks is exposing critical infrastructure systems—like access... threat reportot icsquarterlyhiddenequipment https://www.healthcareinfosecurity.com/webinars/webinar-hidden-identity-risks-ai-agents-w-7055?rf=training Webinar | The Hidden Identity Risks of AI AgentsWebinar. . healthcare information security hidden identity riskswebinarai https://www.bankinfosecurity.com/webinars/webinar-hidden-identity-risks-ai-agents-w-7057?rf=training Webinar | The Hidden Identity Risks of AI AgentsWebinar. . bank information security hidden identity riskswebinarai https://haderslevwiki.dk/index.php/AI_Profile_Pictures:_The_Hidden_Benefits_And_Critical_Risks_For_Professional_Branding AI Profile Pictures: The Hidden Benefits And Critical Risks For Professional Branding -... ai profilehidden benefitspicturescriticalrisks https://sogevity.com/toxic-relations-invisible-danger/ Toxic relationships and ageing: hidden health risks Discover how toxic relationships may accelerate biological ageing, increase stress and inflammation, and affect long-term mental and physical health. toxic relationshipsageinghiddenhealthrisks https://www.plusbase.com/feature/ecommerce-hosting The Perfect Ecommerce Hosting Solution, No Hidden Risks Super-charge your business with our comprehensive eCommerce web hosting, including: SSL certificate, unlimited bandwidth, secure shopping cart, and more! ecommerce hostingperfectsolutionhiddenrisks https://www.paymentsecurity.io/webinars/webinar-hidden-identity-risks-ai-agents-w-7055?rf=training Webinar | The Hidden Identity Risks of AI AgentsWebinar. hidden identity riskswebinarai https://www.healthcareinfosecurity.com/webinars/webinar-hidden-identity-risks-ai-agents-w-7055 Webinar | The Hidden Identity Risks of AI AgentsWebinar. . healthcare information security hidden identity riskswebinarai https://www.databreachtoday.asia/webinars/webinar-hidden-identity-risks-ai-agents-w-7057 Webinar | The Hidden Identity Risks of AI AgentsWebinar. . data security breach hidden identity riskswebinarai https://www.govinfosecurity.com/webinars/webinar-hidden-identity-risks-ai-agents-w-7055 Webinar | The Hidden Identity Risks of AI AgentsWebinar. . government information security hidden identity riskswebinarai https://www.devicesecurity.io/webinars/webinar-hidden-identity-risks-ai-agents-w-7055 Webinar | The Hidden Identity Risks of AI AgentsWebinar. hidden identity riskswebinarai https://www.eurohomecare.com/identifying-hidden-safety-risks-in-older-homes-before-incidents-occur Identifying Hidden Home Safety Risks for Seniors May 28, 2026 - Discover common hidden safety risks in older homes and how home care support can help seniors stay safe without major renovations. safety risksidentifyinghiddenseniors https://kjp-plumbing-southampton.co.uk/moldleaks The Hidden Health Risks in Your Tap: How Plumbing Issues Can Affect Women’s Health Discover how plumbing issues like bacteria, leaks and poor water quality can impact women’s health, and what to check in your home to stay safe. health riskshiddentapplumbingissues https://www.businessblogs.sg/the-ultimate-guide-to-mold-removal-in-singapore-protecting-your-home-from-hidden-health-risks/ The Ultimate Guide to Mold Removal in Singapore: Protecting Your Home from Hidden Health Risks -... The Ultimate Guide to Mold Removal in Singapore: Protecting Your Home from Hidden Health Risks Singapore’s tropical climate brings warmth, greenery, and... ultimate guidemold removalsingaporeprotectinghidden https://AllTradesJournal.com/automotive-services/australian-fuel-pump-market-risks Australian Fuel Pump Market: Booming Sales, Hidden Safety Risks | AllTradesJournal May 8, 2026 - Up to 12% of automotive fuel transfer pumps listed online in Australia fail basic safety checks, posing a significant risk to drivers. fuel pumpsafety risksaustralianmarketbooming https://aurawordss.com/hidden-everyday-risks-for-aging-adults-and-how-to-prevent-them/ Hidden Everyday Risks for Aging Adults and How to Prevent Them - Aura Wordss Mar 31, 2026 - Life in later years brings comfort, wisdom, and meaningful experiences. At the same time, daily routines can come with small but important safety challenges. hiddeneverydayrisksagingadults https://www.ot.today/webinars/webinar-hidden-identity-risks-ai-agents-w-7055 Webinar | The Hidden Identity Risks of AI AgentsWebinar. hidden identity riskswebinarai https://www.cuinfosecurity.com/webinars/webinar-hidden-identity-risks-ai-agents-w-7055 Webinar | The Hidden Identity Risks of AI AgentsWebinar. . credit unions information security hidden identity riskswebinarai https://mlsecops.com/podcast/ai-security-vulnerability-detection-and-hidden-risks-in-model-files AI Security: Vulnerability Detection and Hidden Model File Risks Dec 9, 2024 - Explore model file vulnerabilities, the evolution of AI security, and how MLSecOps and tools like huntr drive proactive protection in AI pipelines. ai securityvulnerability detectionhiddenmodelfile https://www.channelnewsasia.com/watch/doctors-warn-hidden-cancer-risks-caution-against-excessive-or-unproven-tests-6082176 Doctors warn of hidden cancer risks but caution against excessive or unproven tests - CNA Apr 26, 2026 - Doctors are urging the public to seek medical advice when abnormal symptoms arise, following the death of local marathoner Eugene Lim. Despite early warning... doctorswarnhiddencancerrisks https://www.seymourtelegraph.com.au/news/lithium-ion-batteries-in-everyday-devices-pose-a-hidden-fire-risk-4/ Hidden fire risks in everyday devices | Seymour Telegraph “Lithium-ion batteries have become part of everyday life, but many people still underestimate the fire risk.” hiddenfireriskseverydaydevices https://www.synchronous-science.co.uk/ Synchronous Science | Uncover Hidden Electromagnetic Risks Sep 17, 2025 - Uncover hidden electromagnetic risks and act with clarity. Synchronous Science helps defence and security teams secure mission success. uncover hiddensynchronousscienceelectromagneticrisks https://www.govinfosecurity.com/webinars/webinar-hidden-identity-risks-ai-agents-w-7055?rf=training Webinar | The Hidden Identity Risks of AI AgentsWebinar. . government information security hidden identity riskswebinarai https://www.bankinfosecurity.in/webinars/webinar-hidden-identity-risks-ai-agents-w-7057?rf=training Webinar | The Hidden Identity Risks of AI AgentsWebinar. . bank information security hidden identity riskswebinarai https://thekyb.com/blog/adverse-media-screening-a-way-forward-to-uncover-hidden-business-risks/ Adverse Media Screening: A Way Forward to Uncover Hidden Business Risks Oct 10, 2024 - Seeking solutions to safeguard your business against potential risks and negative media coverage? Adverse media screening can help you uncover business risks. media screeningway forwarduncover hiddenadversebusiness https://www.sciencealert.com/hidden-mental-health-risks-of-perimenopause-identified-for-first-time Hidden Mental Health Risks of Perimenopause Identified For First Time : ScienceAlert Women going through perimenopause – the transition period surrounding the menopause – are more than twice as likely to develop bipolar disorder for the first... mental healthfirst timehiddenrisksperimenopause https://www.databreachtoday.eu/webinars/webinar-hidden-identity-risks-ai-agents-w-7057?rf=training Webinar | The Hidden Identity Risks of AI AgentsWebinar. . data security breach hidden identity riskswebinarai https://www.fraudtoday.io/webinars/webinar-hidden-identity-risks-ai-agents-w-7055?rf=training Webinar | The Hidden Identity Risks of AI AgentsWebinar. hidden identity riskswebinarai https://www.swecogroup.com/corporate-news/sweco-analysis-shows-the-challenge-posed-by-hidden-water-risks-to-europes-long-term-resilience/ Sweco Group - Sweco analysis shows the challenge posed by hidden water risks to Europe’s long‑term... sweco groupanalysisshowschallengeposed https://www.shenqiu123.com/sexual/1630.html Throat Discomfort Unveiled: The Hidden Health Risks Behind Chronic Hoarseness Through Dual Lens of... When a persistent hoarseness lingers beyond two weeks, it often serves as a silent alarm—not merely ... health risksdual lensthroatdiscomfortunveiled https://www.ot.today/webinars/webinar-hidden-identity-risks-ai-agents-w-7055?rf=training Webinar | The Hidden Identity Risks of AI AgentsWebinar. hidden identity riskswebinarai https://www.cxtoday.com/security-privacy-compliance/your-cx-stack-is-compliant-but-still-exposing-customer-data-at-every-interaction/ The Hidden Customer Data Risks Inside Your CX Stack A passed audit doesn't protect customer data. See where CX stacks expose sensitive data - and how to close the gaps now. customer datahiddenrisksinsidecx https://wunwun.com/travel-tips/hidden-injury-risks-in-popular-tourist-attractions/ Hidden Injury Risks in Popular Tourist Attractions - Wun Wun Mar 5, 2026 - Travel is meant to be exciting, relaxing, and full of memorable experiences. From bustling city centers to iconic entertainment hubs, tourist attractions are... popular touristhiddeninjuryrisksattractions https://www.vilofoss.com/News/MYCOSAFE-Protection-against-hidden-mycotoxin-risks MYCOSAFE™: Protection against hidden mycotoxin risks - Vilofoss International MYCOSAFE: Protection against hidden mycotoxin risks protectionhiddenmycotoxinrisksvilofoss https://www.devicesecurity.io/webinars/webinar-hidden-identity-risks-ai-agents-w-7055?rf=training Webinar | The Hidden Identity Risks of AI AgentsWebinar. hidden identity riskswebinarai https://fitweb.me/the-hidden-cybersecurity-risks-of-gacor-slot-link-aggregators/ The Hidden Cybersecurity Risks of Gacor Slot Link Aggregators - FitWeb The allure of a “slot gacor” or a supposedly “hot” slot machine is a powerful draw for online gamblers. Platforms like BASKET168, which aggregate links to such... cybersecurity risksgacor slothiddenaggregatorsfitweb https://aiuse.blog/ai-wearables-medical-data-hidden-privacy-risks/ AI Wearables And Medical Data: Hidden Privacy Risks Feb 12, 2026 - AI wearables in healthcare: understand medical data risks, GDPR duties, and clear privacy criteria to choose safer devices for long‑term health monitoring. ai wearablesmedical datahiddenprivacyrisks https://www.cuinfosecurity.com/webinars/webinar-hidden-identity-risks-ai-agents-w-7055?rf=training Webinar | The Hidden Identity Risks of AI AgentsWebinar. . credit unions information security hidden identity riskswebinarai https://www.ndss-symposium.org/ndss-paper/demystifying-rpki-invalid-prefixes-hidden-causes-and-security-risks/ Demystifying RPKI-Invalid Prefixes: Hidden Causes and Security Risks - NDSS Symposium security risksdemystifyingrpkiinvalidprefixes