Robuta

https://peps.python.org/pep-0420/ PEP 420 – Implicit Namespace Packages | peps.python.org Namespace packages are a mechanism for splitting a single Python package across multiple directories on disk. In current Python versions, an algorithm to... namespace packagespepimplicitpython https://marcoamonteiro.github.io/pi-GAN-website/ pi-GAN: Periodic Implicit Generative Adversarial Networks for 3D-Aware Image Synthesis pi-GAN: Periodic Implicit Generative Adversarial Networks for 3D-Aware Image Synthesis https://imperfectcognitions.blogspot.com/2020/07/how-to-tackle-discomfort-when.html How to tackle discomfort when confronting implicit biases A blog about imperfect cognitions, such as delusional beliefs, distorted memories, confabulatory explanations, and implicit biases. how totacklediscomfortconfrontingimplicit https://hitchdev.com/strictyaml/why/implicit-typing-removed/ The Norway Problem - why StrictYAML refuses to do implicit typing and so should you - HitchDev https://implicit.us/ implicit us - Implicit US Jul 23, 2026 - Implicit US Creative Design Agency offers branding, marketing and web design services designed to kindle powerful, continual brand growth. implicitus https://proceedings.neurips.cc/paper_files/paper/2025/hash/0f234479d4be0102b6a9ec5ebf75e881-Abstract-Conference.html FlyLoRA: Boosting Task Decoupling and Parameter Efficiency via Implicit Rank-Wise Mixture-of-Experts https://regent-lang.org/ Regent: a Language for Implicit Task-based Parallelism | Regent regentlanguageimplicittaskbased https://openreview.net/forum?id=EVFrjBgYsPZ ROAD: Learning an Implicit Recursive Octree Auto-Decoder to Efficiently Encode 3D Shapes |... We propose ROAD, an implicit Recursive Octree Auto-Decoder to efficiently and accurately encode large datasets of complex 3D shapes. https://mail.python.org/archives/list/mailman-developers@python.org/message/F4ISASQABEVPUZLXKLIPRQCN2RO46VZ6/ Mailman 3 [Mailman-Developers] Option to supress "msg has implicit dest" behaviour? -... mailmandevelopersoption https://adnjavainterview.blogspot.com/2014/07/what-are-implicit-objects-in-jsp.html Java tutorial and Java Interview Questions and Answers: What are the Implicit Objects in JSP? what are the implicit objects in jsp?,list out the implicit objects in jsp,j2ee interview questions with answers https://kr.mathworks.com/help/coder/ug/optimize-implicit-expansion-in-generated-code.html Optimize Implicit Expansion in Generated Code - MATLAB & Simulink Implicit expansion in the generated code is enabled by default. generated codeoptimizeimplicitexpansionmatlab https://lists.w3.org/Archives/Public/public-html-bugzilla/2011Aug/0341.html [Bug 13531] use of implicit labels in examples from bugzilla@jessica.w3.org on 2011-08-03... https://isprs-annals.copernicus.org/articles/X-4-W1-2022/215/2023/ ISPRS-Annals - ASSESSING THE RELIABILITY OF CONTRIBUTORS IN VGI USING IMPLICIT FACTORS isprs annals https://arxiv.org/abs/1807.03149 [1807.03149] Learning models for visual 3D localization with implicit mapping Abstract page for arXiv paper 1807.03149: Learning models for visual 3D localization with implicit mapping learning models https://isps.yale.edu/research/data/d043?order=field_data_file_size&sort=desc Testing the Implicit-Explicit Model of Racialized Political Communication | Institution for Social... https://lists.w3.org/Archives/Public/public-pfwg/2015Nov/0043.html RE: HTML5 default implicit semantics from Cynthia Shelly on 2015-11-06 (public-pfwg@w3.org from... https://theacademy.sdsu.edu/programs/apswi/supervisor-training/aps-supervisor-core/implicit-bias-structural-racism-2/ APS Supervisor Core: Understanding Implicit Bias and Structural Racism Instructor-Led Training -... Revolutionizing the way people work to ensure the world is a healthier place. supervisor coreimplicit bias https://arxiv.org/abs/2510.02300 [2510.02300] Equilibrium Matching: Generative Modeling with Implicit Energy-Based Models Abstract page for arXiv paper 2510.02300: Equilibrium Matching: Generative Modeling with Implicit Energy-Based Models generative modelingenergy basedequilibriummatching https://ame.usc.edu/2023/03/learning-multimodal-bipedal-locomotion-and-implicit-transitions-a-versatile-policy-approach/ Learning Multimodal Bipedal Locomotion and Implicit Transitions: A Versatile Policy Approach - USC... Apr 26, 2023 - Published on March 10th, 2023Last updated on April 26th, 2023 https://lacoco-lab.github.io/home/publication/yao2025khop/ Language models can learn implicit multi-hop reasoning, but only if they have lots of training data... https://www.frontiersin.org/journals/psychology/articles/10.3389/fpsyg.2019.01422/full Frontiers | Measurement of the Vertical Spatial Metaphor of Power Concepts Using the Implicit... This experimental study explored the use of the implicit relational assessment procedure (IRAP) for understanding the vertical spatial metaphor of power. In ... of thefrontiersmeasurementvertical https://par.nsf.gov/biblio/10663162 Robust implicit regularization via weight normalization | NSF Public Access Repository This page contains metadata information for the record with PAR ID 10663162 public accessrobustimplicitregularizationvia https://fred.stlouisfed.org/series/A006RD3Q086SBEA Gross private domestic investment (implicit price deflator) (A006RD3Q086SBEA) | FRED | St. Louis Fed Graph and download economic data for Gross private domestic investment (implicit price deflator) (A006RD3Q086SBEA) from Q1 1947 to Q1 2026 about implicit price... https://experts.arizona.edu/en/publications/implicit-assumptions-of-conceptual-diagrams-in-environmental-scie/ Implicit assumptions of conceptual diagrams in environmental science and best practices for their... https://ri.diva-portal.org/smash/record.jsf?pid=diva2:1851594 Implicit and explicit subgrid modeling in LES applied to a marine propeller https://www.edweek.org/leadership/opinion-my-district-reversed-course-on-the-implicit-bias-training-we-need/2020/11 My District Reversed Course on the Implicit Bias Training We Need. What Now? (Opinion) Mar 25, 2025 - The principal advice column takes on communicating district decisions you disagree with, optimizing virtual lunch bunches, and more. https://kb.wisc.edu/dairynutrient/875CCISIF/feedback.php?action=2&help=suggest&id=132231 Feedback: Implicit Association Test (IAT) implicit association testfeedback https://scholars.uky.edu/en/publications/implicit-land-use-mapping-using-social-media-imagery/ Implicit Land Use Mapping Using Social Media Imagery - University of Kentucky using social medialand useuniversity ofimplicitmapping https://dukespace.lib.duke.edu/items/9ca0a3fd-8191-445d-9850-d1a10ac772f0/full The Roles of Explicit and Implicit Memory on Aesthetic Experiences of Visual Art the roles https://essic.umd.edu/events/the-use-of-implicit-and-explicit-approaches-to-assess-future-changes-in-extreme-thunderstorm-event-characteristics/ The Use of Implicit and Explicit Approaches To Assess Future Changes in Extreme Thunderstorm Event... Sep 5, 2023 - Prof. Robert J. Trapp Head of Department of Atmospheric Sciences University of Illinois Urbana-Champaign Monday November 28, 2022, 2 PM ET Abstract: The number... https://pylint.readthedocs.io/en/stable/user_guide/messages/warning/implicit-str-concat-in-sequence.html implicit-str-concat-in-sequence / W1403 - Pylint 4.0.5 documentation in sequenceimplicitstrconcat https://lists.w3.org/Archives/Public/public-pfwg/2015Mar/0161.html Re: Question about "Implicit value for Role" from Shane McCarron on 2015-03-24 (public-pfwg@w3.org... https://tobias-lib.uni-tuebingen.de/xmlui/handle/10900/88884 P188 counteracting implicit conflicts by cathodal tDCS to the prefrontal cortex to theimplicitconflicts https://it.mathworks.com/help/coder/ug/optimize-implicit-expansion-in-generated-code.html Optimize Implicit Expansion in Generated Code - MATLAB & Simulink Implicit expansion in the generated code is enabled by default. generated codeoptimizeimplicitexpansionmatlab https://www.developer.amazon.com/en-US/docs/alexa/account-linking/configure-implicit-grant.html Configure an Implicit Grant | Alexa Skills Kit The Alexa Skills Kit supports implicit grants for account linking in custom skills. alexa skillsconfigureimplicitgrantkit https://mail.python.org/archives/list/python-dev@python.org/message/RLLRNXQBBFNVTWJMBSGWRZD7PLX2QD4I/ Mailman 3 Re: [Python-Dev] [OT] implicit return values - Python-Dev - python.org python devreturn valuesmailmanotimplicit https://research.facebook.com/publications/krisp-integrating-implicit-and-symbolic-knowledge-for-open-domain-knowledge-based-vqa/ KRISP: Integrating Implicit and Symbolic Knowledge for Open-Domain Knowledge-Based VQA - Meta... In this work we study open-domain knowledge, the setting when the knowledge required to answer a question is not given/annotated, neither at training nor test... https://www.mass.gov/info-details/implicit-bias-resource-page Implicit Bias Resource Page | Mass.gov Continuing Medical Education on Implicit Bias in Healthcare implicit biasresource pagemass https://research.google/pubs/the-geometric-occams-razor-implicit-in-deep-learning/ The Geometric Occam's Razor Implicit in Deep Learning in deepgeometricoccamrazorimplicit https://se.mathworks.com/help/symbolic/sym.fimplicit.html fimplicit - Plot implicit symbolic equation or function - MATLAB This MATLAB function plots the implicit symbolic equation or function f over the default interval [-5 5] for x and y. plotimplicitsymbolicequationfunction https://mail.gnome.org/archives/gtk-list/2002-February/msg00243.html Re: ?? warning: ANSI C++ forbids implicit conversion from `void * ' in i ansi cimplicit conversionwarning https://repository.lib.ncsu.edu/items/4b0e1bfd-98d8-41fb-9585-55776f9649e8/full Trust in Leadership: The Role of Implicit Leadership Theory Congruence Research on trust has increased in recent years as has research on implicit leadership theory (ILT). However, there is a paucity of research on the... the roletrustleadershipimplicittheory https://yoannjulliard.netlify.app/tag/implicit-social-cognition/ implicit social cognition | Yoann Julliard Independent Researcher social cognitionimplicityoannjulliard https://pmc.ncbi.nlm.nih.gov/articles/PMC10240302/ Assessment of implicit COVID-19 attitudes using affective priming for pro-vaccine and... The COVID-19 pandemic has resulted in the introduction of pharmaceutical and non-pharmaceutical interventions such as precautionary behaviours. The current... https://internals.rust-lang.org/t/pre-rfc-proposal-bound-cargos-implicit-upward-discovery-for-config-toml-files/24210 [Pre-RFC] Proposal: bound Cargo's implicit upward discovery for config.toml files - cargo - Rust... Apr 29, 2026 - Proposal: bound Cargo's implicit upward discovery Cargo currently walks from cwd toward filesystem root when discovering .cargo/config.toml. That is useful... https://impacts.ucar.edu/en/publications/a-mass-conservative-semi-implicit-semi-lagrangian-limited-area-sh/ A mass-conservative semi-implicit semi-Lagrangian limited-area shallow-water model on the sphere -... https://researchportalplus.anu.edu.au/en/publications/distinguishing-true-from-false-memories-via-lexical-decision-as-a/ Distinguishing true from false memories via lexical decision as a perceptual implicit test - The... https://collaborate.princeton.edu/en/publications/the-relationship-between-parental-racial-attitudes-and-childrens-/ The relationship between parental racial attitudes and children's implicit prejudice - Princeton... the relationship https://support.sw.siemens.com/en-US/okba/AL34092/HyperWorks-20221-Implicit-Solver-Interface-New-Feature-Enhancements/index.html HyperWorks 2022.1 Implicit Solver Interface - New Feature Enhancements new featurehyperworksimplicitsolverinterface https://collaborate.princeton.edu/en/publications/multi-level-solution-strategies-for-implicit-time-discontinuous-g/fingerprints/ Multi-Level Solution Strategies for Implicit Time Discontinuous Galerkin Discretizations -... multi levelsolutionstrategiesimplicittime https://slim.gatech.edu/content/extending-search-space-time-domain-adjoint-state-fwi-w-randomized-implicit-time-shifts Extending the search space of time-domain adjoint-state FWI w/ randomized implicit time shifts |... https://scholars.lib.ntu.edu.tw/entities/publication/0eb8ba95-22aa-4564-a2b4-154815029424 The Implicit Association between the Concept of Diligence with Morality and Moral Emotion in... Past research has shown that industry is a highly emphasized concept in culturally Chinese learning environment. Consequently, it seems inevitable for Chinese... https://is.mpg.de/publications/jin-etal-2024-implicit Implicit Personalization in Language Models: A Systematic Study | MPI-IS Our goal is to understand the principles of Perception, Action and Learning in autonomous systems that successfully interact with complex environments and to... language modelsimplicitpersonalizationsystematicstudy https://downloads.haskell.org/ghc/latest/docs/users_guide/exts/implicit_parameters.html 6.11.6. Implicit parameters — Glasgow Haskell Compiler 9.14.1 User's Guide https://pkg.go.dev/git.runstone.com/DataCollect-BD/cisco-network-telemetry-proto/proto_go/cisco_ios_xr_ncs6k_acl_oper/access_list_hardware/nodes/node/egress/ipv4/accesses/access/implicit cisco_ios_xr_ncs6k_acl_oper_access_list_hardware_nodes_node_egress_ipv4_accesses_access_implicit... https://math.berkeley.edu/publications/efficient-solvers-implicit-time-integration-matrix-free-high-order-methods Efficient solvers for the implicit time integration of matrix-free high-order methods | Department... https://infoscience.epfl.ch/entities/publication/d114d812-1561-462b-abfc-87b94f8e4895 Simplicitly: Foundations and Applications of Implicit Function Types Understanding a program entails understanding its context; dependencies, configurations and even implementations are all forms of contexts. Modern programming... foundationsapplicationsimplicitfunctiontypes https://svn.haxx.se/dev/archive-2002-07/0385.shtml Subversion Dev: Re: Revert has no implicit dot-target. subversiondevrevertimplicitdot https://se.mathworks.com/matlabcentral/answers/2008322-plotting-variables-from-an-implicit-function Plotting variables from an implicit function - MATLAB Answers - MATLAB Central Plotting variables from an implicit function. Learn more about solving non linear equation MATLAB plottingvariablesimplicitfunctionmatlab https://engagement.uic.edu/diversity-education/bias-reporting-and-education/resources-on-implicit-bias/ Resources on Implicit Bias | Office of the Vice Chancellor for Engagement | University of Illinois... office of the vice chancellor https://mail.python.org/pipermail/mailman-users/2000-April/004313.html [Mailman-Users] implicit approval mailmanusersimplicitapproval https://gcorr.teachable.com/courses/moacimplicitbias/lectures/38268894 Transforming Implicit Bias: Possible Texts (Matthew 15:21-28) | GCORR: A resource for leaders, preachers, and congregations who want to learn and teach about implicit bias. implicit biastransformingpossibletextsmatthew https://washparkprophet.blogspot.com/2009/11/who-faces-implicit-high-marginal-tax.html Wash Park Prophet: Who Faces Implicit High Marginal Tax Rates? There are people in the United States who face marginal tax rates close to 100%. Who are they? Not the rich, but the working poor . For a ... wash parkprophetfacesimplicithigh https://docs.cloud.google.com/security-command-center/docs/findings/threats/ai-agent-suspicious-token-generation-implicit-delegation Privilege Escalation: AI Agent Suspicious Token Generation Using Implicit Delegation | Security... Learn more about 'Privilege Escalation: AI Agent Suspicious Token Generation Using Implicit Delegation' threat findings. privilege escalationai agenttoken generationsuspicious https://www.scirp.org/journal/paperinformation?paperid=54686 Implicit, Context Management Systems for Mobile Health Services Discover how context aware systems can enhance risk management in Mobile Health services. Learn about the executive model and clinical risk management plan for... context managementfor mobileimplicitsystemshealth https://mail.python.org/pipermail/mailman-users/2001-January/008801.html [Mailman-Users] Implicit Destination mailmanusersimplicitdestination https://lt3.ugent.be/publications/interpretation-modeling-social-grounding-of-senten/ Interpretation modeling : social grounding of sentences by reasoning over their implicit moral... LT3, Language and Translation Technology Team, is a research group at Ghent University's Department of Translation, Interpreting and Communication which... https://www.answers.com/basic-math/What_are_the_Implicit_object_in_JSP What are the Implicit object in JSP? - Answers The implicit objects in a JSP page are:requestresponsepageContextsessionapplicationoutconfigpage implicitobjectjspanswers https://html5-player.libsyn.com/embed/episode/id/11650508/height/84/theme/custom/thumbnail/no/direction/backward/tdest_id/36690205/render-playlist/no/custom-color/42174e/ Episode 7 - Cultural Competency and Implicit Bias cultural competencyepisodeimplicitbias https://eric.ed.gov/?id=EJ933737 ERIC - EJ933737 - Implicit Sequence Learning and Contextual Cueing Do Not Compete for Central... Sequence learning and contextual cueing explore different forms of implicit learning, arising from practice with a structured serial task, or with a search... https://techcommunity.microsoft.com/blog/sqlserver/name-resolution-default-schema-implicit-schema-part-iii/383054 Name resolution, default schema, implicit schema Part III | Microsoft Community Hub Mar 23, 2019 - First published on MSDN on Apr 03, 2006 It is time to cover name resolution algorithm in SQL 2005 for objects. name resolutionpart iiimicrosoft communitydefaultschema https://www.cato.org/blog/instant-analysis-implicit-tax-rates-new-obama-proposal Instant Analysis of Implicit Tax Rates in New Obama Proposal | Cato at Liberty Blog https://eric.ed.gov/?id=EJ1310642 ERIC - EJ1310642 - What's with the Attitude? Implicit Attitudes and Critical Thinking in... Current faculty and other stakeholders for higher education have cited a lack of critical thinking within traditional undergraduate students. Some have touted... https://lorenzopareschi.blogspot.com/2013/05/implicit-explicit-runge-kutta-schemes.html Lorenzo Pareschi: Implicit-Explicit Runge-Kutta schemes for the Boltzmann-Poisson system for... Giacomo Dimarco, Lorenzo Pareschi, Vittorio Rispoli (15/5/2013 Communications in Computational Physics , 15, pp.1291-1319, 2014 , arXi... https://johanwind.github.io/2022/07/06/dln_classifier.html Implicit bias by small initialization: A simple classification task where deeper is better | The... Jul 6, 2022 - In this blog post I will show an example of implicit bias on a synthetic classification task. https://learn.microsoft.com/en-us/dotnet/api/microsoft.azure.commands.profile.models.core.psazureprofile.op_implicit?view=az-ps-latest PSAzureProfile.Implicit Operator (Microsoft.Azure.Commands.Profile.Models.Core) | Microsoft Learn Convert between implementations of AzureProfile. microsoft azureprofile modelsimplicitoperatorcommands https://infoscience.epfl.ch/entities/publication/0dde0307-a262-476c-a20c-e52bd7820ae5 PIROCK: a swiss-knife partitioned implicit-explicit orthogonal Runge-Kutta Chebyshev integrator for... A partitioned implicit-explicit orthogonal Runge-Kutta method (PIROCK) is proposed for the time integration of diffusion-advection-reaction problems with... https://mail.python.org/archives/list/python-dev@python.org/message/BTVRVUFFZZRELRPHP2SWAPYNO3OS3JIU/ Mailman 3 [Python-Dev] Divorcing str and unicode (no more implicit conversions). - Python-Dev -... python dev https://ja.dh.duke.edu/content/communication-skills-and-mitigation-implicit-bias Communication Skills and Mitigation of Implicit Bias | DUKEHealth JA communication skillsimplicit biasmitigationja https://pure.psu.edu/en/publications/statistical-inference-for-a-system-of-simultaneous-non-linear-imp/ Statistical inference for a system of simultaneous, non-linear, implicit equations in the context... https://www.maxwell.syr.edu/research/center-for-policy-research/events/webinar-series-on-property-tax-administration-and-design/papers/implicit-land-taxes-and-their-effect-on-the-real-economy Implicit Land Taxes and Their Effect on the Real Economy This paper shows that land taxes are associated with higher density, neighborhood diversity, business formation, and other indicators of economic performance. land taxeson theimpliciteffectreal https://meetings-archive.aps.org/shock/2022/m01/5/ Implicit Shock-Fitting of Detonations in Condensed Explosives - Continental Breakfast - Platinum... We present numerical simulations of steady and unsteady detonations using the Moving Discontinuous Galerkin with Interface Condition Enforcement (MDG-ICE) metho continental breakfastimplicitshockfittingdetonations https://4freecle.blogspot.com/2025/02/february-20-civility-part-two.html Free Online CLE & MCLE for Attorneys and Lawyers: February 20: The Janus Face of Implicit Bias:... Free online CLE and MCLE for attorneys and lawyers, offering popular ethics courses and a wide range of Continuing Legal Education topics. https://pure.lib.usf.edu/en/publications/on-making-forecasts-from-binary-sequences-uncovering-implicit-cue-2/ On making forecasts from binary sequences: Uncovering implicit cues - University of South Florida https://github.com/cogpp/datetime-generator GitHub - cogpp/datetime-generator: The is a set of Arbitrary implicit values to property test with... The is a set of Arbitrary implicit values to property test with java.time and scalacheck. - cogpp/datetime-generator https://bcommons.berkeley.edu/compressing-high-capacity-models-implicit-neural-networks-and-frank-wolfe Compressing High Capacity Models with Implicit Neural Networks and Frank-Wolfe | Open Research... https://perldoc.perl.org/5.42.2-RC1/encoding::warnings encoding::warnings - Warn on implicit encoding conversions - Perldoc Browser implicit conversionsencodingwarningsbrowser https://openresearch-repository.anu.edu.au/items/12404d4e-c3f6-482c-ac24-7d9c90f7b356/full Implicit learning as a mechanism for syntactic acquisition and processing: Evidence from syntactic... Learning to decode and communicate meaning from how words are combined is a challenge that children must meet in order to acquire the syntax of their language.... as a https://arxiv.org/abs/2207.06955v1 [2207.06955v1] Learning Implicit Templates for Point-Based Clothed Human Modeling Abstract page for arXiv paper 2207.06955v1: Learning Implicit Templates for Point-Based Clothed Human Modeling clothed humanlearningimplicittemplates https://google.github.io/tensorstore/python/api/tensorstore.Schema.mark_bounds_implicit.html tensorstore.Schema.mark_bounds_implicit - TensorStore schemamarkboundsimplicit https://data.mendeley.com/datasets/w7bgjcxbxb/3 Implicit Extrapolation and the Beliefs Channel of Investment Demand (FINEC-D-23-00484) - Mendeley... These folders contain the code, data, and output to reproduce the exhibits in "Implicit Extrapolation and the Beliefs Channel of Investment Demand" by Haoyang... https://perldoc.perl.org/5.41.12/encoding::warnings encoding::warnings - Warn on implicit encoding conversions - Perldoc Browser implicit conversionsencodingwarningsbrowser https://dev.mysql.com/doc/dev/mysql-server/latest/classImplicit__substatement__state__guard.html MySQL: Implicit_substatement_state_guard Class Reference state guardmysqlimplicitclassreference https://dukespace.lib.duke.edu/items/608382d1-1873-465b-a27b-865b1cf17e35/full The temporal dynamics of implicit processing of non-letter, letter, and word-forms in the human... The decoding of visually presented line segments into letters, and letters into words, is critical to fluent reading abilities. Here we investigate the... https://pubmed.ncbi.nlm.nih.gov/32839234/ When Implicit Prosociality Trumps Selfishness: The Neural Valuation System Underpins More Optimal... Humans learn quickly which actions cause them harm. As social beings, we also need to learn to avoid actions that hurt others. It is currently unknown whether... https://www.ks.uiuc.edu/Research/namd/mailing_list/namd-l.2015-2016/1192.html namd-l: time per step during GPU-accelerated Implicit Solvent calculations namdltimeperstep https://researchfestival.nih.gov/2024/posters/examining-associations-between-regional-food-related-implicit-biases-and Examining associations between regional food-related implicit biases and regional obesogenic and... regional foodexaminingassociationsrelatedimplicit https://developers.redhat.com/blog/2019/04/22/implicit-function-declarations-flexs-use-of-reallocarray Implicit function declarations: flex's use of "reallocarray" | Red Hat Developer Apr 17, 2019 - Compatibility with existing build systems is improved if "reallocarray" is declared under _DEFAULT_SOURCE in Fedora's flex package. flex sred hatimplicitfunctiondeclarations https://mail.python.org/pipermail/mailman-users/1999-March/000718.html [Mailman-Users] Held for Implicit Destination mailmanusersheldimplicitdestination https://learn.mit.edu/search?resource=12352 Implicit Differentiation | MIT Learn implicit differentiationmitlearn