https://fxnewsgroup.com/forex-news/institutional/marex-spectron-establishes-uk-focused-equities-market-making-franchise/
Marex Spectron establishes UK-focused equities market making franchise - FX News Group
Feb 9, 2021 - Marex Spectron launches a new UK-focused equities market making franchise to cover AIM, small and mid-cap stocks.
fx news groupequities marketmarexspectronuk
https://www.binance.th/en/aboutus/latest-release/4ec466f569da4e3785459632a76d4446
Public Hearing on Market Making Rules | Binance TH
public hearingmarket makingrulesbinanceth
https://capwolf.com/galaxy-digital-eyes-market-making-on-polymarket-and-kalshi/
Galaxy Digital Eyes Market Making on Polymarket and Kalshi
Nov 25, 2025 - Galaxy Digital is negotiating to become a major liquidity provider on Polymarket and Kalshi as prediction markets explode in volume and institutional interest...
market makinggalaxydigitaleyespolymarket
https://www.prnewswire.co.uk/news-releases/sucden-financial-commences-stir-market-making-301640628.html
Sucden Financial Commences STIR Market Making
/PRNewswire/ -- Sucden Financial, the multi-asset execution, clearing and liquidity provider, has announced it is now a market maker for ICE Futures Europe's...
market makingfinancialstir
https://liquidityfinder.com/insight/broker-insights/b-book-management-market-making-within-a-retail-fx-cfd-broker-environment
B-Book Management: Market Making Within A Retail FX CFD Broker En
Brokers who decide to Run A B-Book Do So Primarily Because The Profit Potential Per Unit Traded Is Consistently Higher When Responsibly Managed, Than An A-Book...
book managementmarket makingretail fxcfd brokerwithin
https://bitcoinworld.co.in/hyperliquid-market-making-pool-attack/?v=1775709626
Hyperliquid Market-Making Pool Hit By Devastating $1.5M Fartcoin Attack Exploiting Auto-Delivering
Apr 9, 2026 - Hyperliquid market-making pool loses $1.5M in a sophisticated Fartcoin attack exploiting low liquidity and auto-deleveraging mechanisms in decentralized...
market makinghyperliquidpoolhitdevastating
https://www.bee.com/ur/66585.html
Fundraising, Pricing, Market Making All in One Click: HIP-6 Aims to Make Hyperliquid the Go-to...
Compiled by: TechFlow Introduction: This is a comprehensive Hyperliquid Improvement Proposal (HIP) that proposes introducing a Continuous Clearing Auction...
all in onemarket makingto makethe gofundraising
https://jobs.framework.ventures/companies/swell-network/jobs/77378096-experienced-trader-market-making
Experienced Trader Market Making @ Swell Network | Framework Ventures Job Board
Search job openings across the Framework Ventures network.
market makingswell networkjob boardexperiencedtrader
https://proceedings.neurips.cc/paper_files/paper/2013/hash/995e1fda4a2b5f55ef0df50868bf2a8f-Abstract.html
Adaptive Market Making via Online Learning
market makingvia onlineadaptivelearning
https://tokenminds.co/blog/market-making-as-a-service
Market Making Made Easy: Exploring MMaaS for Web3
Market Making Made Easy: Exploring MMaaS for Web3 Discover how Market Making as a Service (MMaaS) helps Web3 projects get the liquidity they need. Attract...
market makingmadeeasyexploringmmaas
https://www.skmurphy.com/blog/2023/08/20/time-to-market-s01e09-making-tough-calls/
Time to Market: Making Tough Decisions as Founders - SKMurphy, Inc.
Jan 21, 2026 - One of the keys to startup success is making tough decisions. This podcast explores several helpful frameworks for effective team decisions.
time to markettough decisionsmakingfoundersinc
https://www.goldmansachs.com/pressroom/press-releases/2002/2002-09-09
Goldman Sachs Integrates GSCO and SLKC Nasdaq Trading and Market Making | Goldman Sachs
goldman sachsmarket makingintegratesnasdaqtrading
https://www.secretstotrading101.com/prop-trading-vs-market-making/
Prop Trading Vs Market Making
Sep 21, 2025 - Discover the core differences between prop trading vs market making and how they shape financial markets today.
prop tradingmarket makingvs
https://www.smithsdetection.com/press-releases/smiths-detection-announces-new-vehicle-mounted-x-ray-system-for-commercial-security-market/
Smiths Detection announces new vehicle-mounted X-ray system for commercial security market | Making...
for commercial securitynew vehiclex raymarket makingsmiths
https://integratormedia.com/2025/02/06/al-ramz-expands-market-making-footprint-in-the-gcc-with-muscat-stock-exchange-license/
Al Ramz Expands Market-Making Footprint in the GCC
Feb 6, 2025 - Al Ramz Corporation PJSC has been granted a market maker license by the Muscat Stock Exchange (MSX), marking a significant milestone in its regional expansion...
market makingthe gccalramzexpands
https://www.newsworthy.ai/curated/mindbio-therapeutics-engages-venture-liquidity-providers-for-mar/202630920
MindBio Therapeutics Engages Venture Liquidity Providers for Market-Making Services | Newsworthy.ai
MindBio Therapeutics has appointed Venture Liquidity Providers to provide market-making services aimed at maintaining orderly trading for its shares, which is...
liquidity providersfor markettherapeuticsengagesventure
https://research-portal.uea.ac.uk/en/publications/market-making-with-learned-beta-policies/
Market Making with Learned Beta Policies - University of East Anglia
market makinguniversity ofeast anglialearnedbeta
https://www.vii.finance/
VII Finance | Credit Based Market Making Protocol
credit basedmarket makingviifinanceprotocol
https://caladan.xyz/
Leading Crypto Market Making & Trading Firm | Caladan
crypto marketleadingmakingtradingfirm
https://www.finanznachrichten.de/nachrichten-2025-06/65671782-neptune-digital-assets-corp-neptune-engages-icp-securities-inc-for-automated-market-making-services-296.htm
Neptune Digital Assets Corp: Neptune Engages ICP Securities Inc. for Automated Market Making...
Vancouver, British Columbia--(Newsfile Corp. - June 16, 2025) - Neptune Digital Assets Corp. (TSXV: NDA) (OTCQB: NPPTF) (FSE: 1NW) ("Neptune" or the...
neptune digital assetsmarket makingcorpengagesicp
https://associative.in/market-making-bot-development-services-ai-blockchain-solutions/
Market Making Bot Development Services | AI & Blockchain Solutions Associative
Mar 23, 2026 - Expert market making bot development by Associative in Pune. We build high-frequency, liquidity-providing trading bots using AI, ML, and Solidity. Secure,...
market making botdevelopment servicesai blockchainsolutionsassociative
https://m.offertoday.com/en/job/MOhde4BaPMy0PdEIbds-9A%3D%3D
Aberdeen Crypto high-frequency market-making arbitrage jobs recruitment-Eva Group -Offertoday
high frequencymarket makingaberdeencryptoarbitrage
https://research.cbs.dk/da/publications/deep-recurrent-q-networks-for-market-making/
Deep Recurrent Q-Networks for Market Making - CBS Forskningsportal
for marketdeeprecurrentqnetworks
https://medicalresearchtv.com/press-release/2025-06-04/19328/hedgue-kicks-off-8th-crypto-market-making-fund-for-institutional-mandators-targeting-a-200m-raise
Hedgue Kicks Off 8th Crypto Market-making Fund for Institutional Mandators Targeting a $200M Raise
Hedgue, a US-based investment bank serving corporate clients, sovereign entities, and financial institutions, is targeting a $200 million raise for it...
crypto marketkicksmakingfundinstitutional
https://rbwms.net/2022/06/10/avellaneda-market-making-hummingbot-docs/
Avellaneda Market Making Hummingbot Docs
market makingavellanedahummingbotdocs
https://www.portofino.tech/
Portofino Technologies | Digital Assets Market Making
Portofino Technologies provides digital asset market making for exchanges, token projects and investors. Built for execution, resilience and precision.
digital assetsmarket makingportofinotechnologies
https://github.com/michaelgrosner/tribeca
GitHub - michaelgrosner/tribeca: A high frequency, market making cryptocurrency trading platform in...
A high frequency, market making cryptocurrency trading platform in node.js - michaelgrosner/tribeca
high frequencymarket makingcryptocurrency tradinggithubtribeca
https://www.risk.net/cutting-edge/banking/7952481/market-making-by-a-foreign-exchange-dealer
Market-making by a foreign exchange dealer - Risk.net
Sep 28, 2022 - An optimal liquidity model for pricing and hedging decisions is presented
market makingforeign exchangedealer risk
https://codetrendy.com/listing/pairtrade
Pairtrade.io - Non-custodial market-making | CodeTrendy
Non-custodial market-making bots for Kraken
market makingiononcustodial
https://repositori.upf.edu/items/0e1fa26b-fbf0-4c6a-acb4-b9045086ee54
e-Repositori UPF :: Giffen goods and market making
This paper shows that information effects per se are not responsible for the Giffen goods anomaly affecting competitive traders demands in multi- asset, noisy...
market makingrepositoriupfgoods
https://www.theitbase.com/business/benefits-and-risks-of-crypto-market-making/
Benefits and Risks of Crypto Market Making - The IT Base
May 9, 2024 - As more and more investors join the frenzy, crypto market making have emerged as crucial players in this exciting domain.
benefits and riskscrypto marketmakingbase
https://wavexcoins.com/market-making-strategies-for-small/
Market Making Strategies for Small: Capital Efficiency Reimagined
Apr 10, 2026 - Dive deep into the world of Market Making Strategies for Small, uncovering the hidden costs of liquidity drain and actionable insights for 2026. Don't let the...
market makingcapital efficiencystrategiessmallreimagined
https://www.fintechinshorts.com/tag/crypto-market-making/
Crypto Market Making Archives - Fintech InShorts: Latest Fintech News, Analysis By Experts
Discover the latest fintech news with Fintech Inshorts, Explore banking trends, financial innovation. expert analyses, blogs and fintech advancements.
latest news analysiscrypto marketby expertsmakingarchives
https://researchrepository.ucd.ie/entities/publication/01bff621-fcb3-458e-87b2-3f54093e46b2
The civilising tension at the heart of market-making: a case study of the stent industry
We are interested in the emergence of new markets. While the literature contains various perspectives on how such new markets come to be, the dynamics of the...
market makingcase studytensionheartstent
https://betcs.in/library/job/derivatives-trader-electronic-market-making-at-orion-placement-chicago-il-RU9aRTNqcUNXMUowc3NvMWRJOUg2WFdCV2c9PQ==
Derivatives Trader - Electronic Market Making job at Orion Placement Chicago, IL, US - betcs.in
Derivatives Trader - Electronic Market Making job at Orion Placement Chicago, IL, US Pay: $150,000.00 - $185,000.00 per year Why This Is a Great Opportunity...
market makingchicago ilderivativestraderelectronic
https://www.nationalbanken.dk/en/government-debt/trading-and-data/primary-dealers-and-market-making
Primary dealers and market making
Primary dealers and market making
primary dealersmarket making
https://www.booktopia.com.au/option-market-making-allen-jan-baird/book/9780471578321.html
Option Market Making by Allen Jan Baird | Trading and Risk Analysis for the Financial and Commodity...
Buy Option Market Making, Trading and Risk Analysis for the Financial and Commodity Option Markets by Allen Jan Baird from Booktopia. Get a discounted...
market makingrisk analysisfor theoptionallen
https://express.ee/en/node/37093
What markets can a Market Making Bot operate in? | Blockchain and
In Market Making Bot development, the bot can operate in various financial markets, including cryptocurrencies, stocks, forex, commodities, and futures. It is...
market making botmarketsoperateblockchain
https://cryptocoinnewstoday.com/km/tag/cryptocurrency-market-making/
Cryptocurrency market making Archives - The Daily Investors | Latest Cryptocurrency News, Trading...
Cryptocurrency market making
cryptocurrency marketthe dailylatest newsmakingarchives
https://www.getsportjobs.com/job/e79edd78-1a0c-45c7-a017-cf0419681746
Quant Trader (Sports Event Market Making) at Crypto.com | GetSportJobs
Quant Trader (Sports Event Market Making) job at Crypto.com in United States. Full-time position. Apply now on GetSportJobs.
quant tradersports eventmarket makingcrypto com
https://repositorio.fgv.br/items/9417cd3c-ae7f-4121-ae3a-2d67476046fa
Designing a systematic market making framework with a statically hedged uncertain volatility model...
This work aims to build a framework that applies the Uncertain Volatility Model alongside Static Hedging to generate competitive markets for European-style...
market makingdesigningsystematicframeworkstatically
https://alphapoint.com/blog/market-making-in-crypto
Crypto Market Making: What It Is and How It Works
Explore the essentials of crypto market making: discover how it works, its benefits, and why it's crucial for liquidity and stability in cryptocurrency markets.
what it iscrypto markethow worksmaking
https://www.livemint.com/market/brokers-pitch-for-equality-in-commodity-marketmaking/amp-11768726572981.html
Will brokers' push for market-making pump up commodity trade liquidity? | Stock Market News
Jan 19, 2026 - ANMI national president requests Sebi to extend equity-style incentives to commodity derivatives segment for deepening markets. Will it help reduce dominance...
for marketpump upstock newsbrokerspush
https://www.chaincatcher.com/en/article/2173998
How does on-chain market making break through indicators and control funds silently? - ChainCatcher
Dynamic adjustment of the metrics used is essential for sustaining progress in this industry.
market makingbreak throughand controlchainindicators
https://rivera.money/
Rivera - Transforming Market Making
Rivera Money is a permissionless liquidity infrastructure for concentrated DEXs.
market makingriveratransforming
https://centensports.com/crypto-market-making-services-what-you-need-to-know/
Crypto Market Making Services: What You Need to Know - Centen Sports
As the world of cryptocurrency continues to grow and evolve, the need for crypto market making services has become increasingly vital. Market making is the
what you needcrypto marketmakingservicesknow
https://www.shine.com/job-search/market-making-jobs-in-meerut
9 Market Making Jobs in Meerut - Market Making Job Vacancies in Meerut - May 2026
Explore Market Making Jobs in Meerut at Shine.com. Discover 9 Market Making job openings in Meerut at top companies. Apply now and land your dream job. Explore...
jobs in meerutmarket makingvacanciesmay
https://www.tradermath.org/market-games
Market Making Games | Trading Interview Practice Simulators - Tradermath
Free browser-based market making and trading simulators. Practice the Trading Game, ETF Arbitrage, Card Game, Market Making Dice Game and Fermi Estimation used...
market makinginterview practicegamestradingsimulators
https://bitcoincashblender.com/bitcoin-market-making-strategies/
Bitcoin Market Making Strategies: The Ultimate Guide
Oct 28, 2025 - Explore essential Bitcoin market making strategies to enhance your trading skills and optimize liquidity in the crypto market.
the ultimate guidemarket makingbitcoinstrategies
https://researchwith.stevens.edu/en/publications/erratum-noise-trader-risk-and-bayesian-market-making-in-fx-deriva/
Erratum: 'Noise-trader risk' and Bayesian market making in FX derivatives: Rolling loaded dice?...
market makingerratumnoisetraderrisk
https://www.borsaitaliana.it/borsaitaliana/regolamenti/guide/marketmakingperformancereport-march2024_pdf.htm
MARKET MAKING PERFORMANCE REPORT - march 2024 - Borsa Italiana
market makingperformance reportborsa italianamarch
https://racefi.io/jump-trading-expands-crypto-market-making-operations/
Jump Trading Expands Crypto Market Making Operations
Jan 19, 2026 - Global trading firm Jump Trading expands its cryptocurrency market making operations, strengthening its position in digital asset trading and enhancing...
market making operationsjumptradingexpandscrypto
https://blockmanity.com/press-release-2/tcv-a-fresh-approach-to-market-making-in-defi/
TCV: a Fresh Approach to Market-making in DeFi - Blockmanity
May 20, 2024 - In the dynamic realm of finance and investment, adaptability is key for long-term success. Recognizing this, TravaCapital, a significant player in the field,...
fresh approachto markettcvmakingdefi
https://www.basispointinsight.com/Story/Author/bond-market-making-needs-capital--not-just-mandates_6d2029390c67.html
BasisPointInsight.com - Bond Market-Making Needs Capital, Not Just Mandates by R. Gurumurthy
India wants market makers to revive corporate bond trading. Even gilts never got meaningful liquidity from mandates. Without risk capital, market-making will...
bond marketnot justmakingneedscapital
https://jobs.theblockchainassociation.org/companies/falconx/jobs/61283294-senior-devops-engineer-market-making
Senior Software Engineer (DevOps) - Market Making @ FalconX | Blockchain Association Job Board
Search job openings across the Blockchain Association network.
senior software engineermarket makingjob boarddevopsfalconx
https://marketmakinggames.com/
Market Making Games
Compete in real-time multiplayer market making games, Fermi questions, and trading simulations designed by quants for aspiring quants.
market makinggames
https://www.isb.edu/faculty-and-research/research-directory/teaching-the-art-of-market-making-with-a-game-simulation
Teaching the Art of Market Making with a Game Simulation
the art ofmarket makingteachinggamesimulation
https://pressreleasehub.pa.media/article/kairon-labs-and-solidus-labs-partner-to-redefine-ethical-market-making-under-mica-34563.html
Kairon Labs and Solidus Labs Partner to Redefine Ethical Market Making Under MiCA
Kairon Labs taps Solidus Labs to provide enhanced market compliance and risk management solutions in preparedness for MiCA compliance.
market makingkaironlabssoliduspartner
https://www.quantblueprint.com/jobs/two-sigma-quantitative-trader-options-market-making
Quantitative Trader - Options Market-Making at Two Sigma | Quant Blueprint
Quantitative Trader - Options Market-Making at Two Sigma in Chicago IL. Apply now on Quant Blueprint.
options markettwo sigmaquantitativetradermaking
https://fibot.xyz/
FiBot Liquidity and Market Making Services
Market maker bot and crypto price bot. Can be set up for pancackeswap, uniswap mdx on BSC chain, ETH Chain and Matic chain.
market makingliquidityservices
https://www.regulationtomorrow.com/2015/11/agencies-address-volcker-rule-questions-on-exiting-market-making-and-prohibitions-on-certain-transactions-with-covered-funds/
Agencies address Volcker Rule questions on exiting market-making and prohibitions on certain...
Nov 25, 2015 - On November 20, 2015, the US financial regulators issued additional guidance regarding (i) exiting permissible marketing making activities under the
on exitingmarket makingagenciesaddressvolcker
https://marketresearchmedia.com/
Market Research Media | taking uncertainty out of decision making
market researchout ofdecision makingmediataking
https://jsafrasarasin.com/fr/our-perspectives/making-the-case-for-investment-grade-emerging-market-bonds.html
Making the case for investment grade emerging market bonds
Investment grade-focused emerging market bonds tend to be underappreciated by investors, and are often misrepresented in portfolio allocations. However, they...
making the casefor investmentemerging marketgradebonds
https://economictimes.indiatimes.com/news/international/us/donald-trump-in-for-making-dubious-history-history-says-a-stock-market-crash-is-within-the-realm-of-possible-outcomes-under-his-presidency-here-are-the-reasons/articleshow/117400120.cms
stock market volatility: Donald Trump in for making dubious history? History says a stock market...
Donald Trumps presidency stirred financial markets in unprecedented ways, with political controversies often triggering stock market fluctuations.
stock market volatilitydonald trumpmakingdubioushistory
https://www.mandg.co.za/insights/articles/naspers-making-sense-of-the-elephant-in-our-equity-market
Naspers: Making sense of the elephant in our equity market
Lynn Bolin, Head of Communications and Equity Analyst Aadil Omar, take a closer look at the Naspers business given its large weighting in the SA equity market
making sensethe elephantequity market
https://auto.hindustantimes.com/auto/news/mahindra-plans-big-for-indian-pv-market-from-23-cars-to-local-ev-battery-making-41718536488632.html
Mahindra plans big for Indian PV market, from 23 cars to local EV battery making | HT Auto
Jun 18, 2024 - Mahindra is adopting a multipronged strategy to increase its market in the Indian passenger vehicle space, in both ICE and EV segments.
pv marketev batteryht automahindraplans
https://marketlavingtonmuseum.org.uk/curators-blog-tags/pond-making
pond making Archives - Market Lavington Museum
pondmakingarchivesmarketlavington
https://coinhubexchange.com/paradigm-mulls-prediction-market-entry-with-trading-terminal-market-making-desk-fortune/
Paradigm mulls prediction market entry with trading terminal, market making desk: Fortune - Coinhub...
Apr 1, 2026 - Paradigm founder and Kalshi board member Matt Huang has previously said that prediction markets represent a trillion-dollar opportunity.
prediction markettrading terminalparadigmentrymaking
https://apac.entrepreneur.com/entrepreneurs/how-this-ceo-is-making-room-for-company-growth-in-a-crowded/354352
How This CEO Is Making Room For Company Growth In a Crowded Market
Oct 4, 2025 - Not content with merely keeping up with competition, Grygoriy Sytenko is leading the company towards disrupting the entire niche
ceo ismaking roomcompanygrowthcrowded