Robuta

https://github.com/brave/brave-search-mcp-server
Contribute to brave/brave-search-mcp-server development by creating an account on GitHub.
brave searchmcp servergithub
https://saviynt.com/blog/saviynt-joins-aws-ai-agent-marketplace-as-launch-partner-with-new-mcp-server-available-today
Saviynt named a launch partner for AWS’ new AI Agents and Tools Category on AWS Marketplace, debuting its new MCP Server.
ai agentsaviyntnamedawsmarketplace
https://mcpservers.com/servers/linear-linear-sse
Linear is the issue tracking tool built for high-performance teams. Access Linear's powerful issue tracking and project management features directly from...
model context protocolmcp serveraddlinearsse
https://nextjs.org/docs/app/guides/mcp
Oct 27, 2025 - Learn how to use Next.js MCP support to allow coding agents access to your application state
next jsmcp serverguides
https://www.itential.com/blog/company/ai-networking/ais-rewriting-automation-itentials-mcp-server-is-your-guide/
Sep 29, 2025 - AI is reshaping automation—but without control. Itential’s new MCP Server gives AI agents the guardrails they need to drive real infrastructure change....
mcp serverrewritingautomationampguide
https://mcpservers.com/servers/lingodotdev-lingo-dev-translation
Enables multilingual content translation for app localization, website content, and text data through a translate tool accessible via npx command with...
mcp serveraddlingodevtranslation
https://freedocs.bluerock.io/bluerock-secure-mcp-server-for-fastmcp/using-the-bluerock-secure-mcp-server-for-fastmcp
mcp serverusingsecurefastmcpfree
https://www.adspirer.com/?ref=fazier
Connect Claude Desktop and ChatGPT to Google Ads & TikTok. The premier MCP server for AI-powered advertising. Create campaigns, analyze performance, and...
mcp servergoogle adsamptiktokconnect
https://miro.com/ai/mcp/
Build AI applications faster with Miro's MCP server integration. Keep your team's context and code connected across LLMs and development tools.
mcp serverai codingmiroconnecttools
https://dxt.so/mcp-server/developer-tools/blender-model-context-protocol-mcp
Connects Blender to Claude AI, enabling prompt-assisted 3D modeling, scene creation, and manipulation.
model context protocolmcp serverblender
https://cyclr.com/product/mcp-paas?ref=startuptrusted
Jan 20, 2026 - Make your SaaS AI ready with your own user configurable MCP marketplace - with security and speed built at its core.
mcppaasturnapiserver
https://wpengine.com/builders/wp-engine-smart-search-mcp-in-headless-wp/
Oct 14, 2025 - A How-to guide to implement WP Engine’s Smart Search MCP in headless WordPress with Next.js + Vercel AI SDK + Google AI.
wp enginesmart searchai modelimplementcontext
https://dxt.so/mcp-server/client/y-cli-client
Enables terminal-based AI conversations with support for multiple AI models and MCP client integration.
mcp servercli
https://fedoramagazine.org/find-out-how-your-fedora-system-really-feels-with-the-linux-mcp-server/
Dec 12, 2025 - Generative AI systems are changing the way people interact with computers. MCP (model context protocol) is a way that enables LLMs to run commands and use...
mcp servertalkfedorasystemlinux
https://dxt.so/mcp-server/developer-tools/tianji-mcp
Tianji - Interact with Tianji platform whatever selfhosted or cloud platform, powered by Tianji.
mcp server
https://about.gitea.com/resources/tutorials/gitea-mcp-server
Gitea - Git with a cup of tea! Painless self-hosted all-in-one software development service, including Git hosting, code review, team collaboration, package...
mcp servergiteanewparadigmai
https://mcpservers.com/clients/highlight
Desktop AI assistant for cross-app productivity and workflow automation.
model context protocolmcp servershighlight
https://www.oktopost.com/blog/oktopost-mcp-server-ai-social-workflows/
Discover how Oktopost's MCP Server connects AI tools to your social media workflows for faster content creation and more innovative campaign management.
social mediamcp serverboostaidriven
https://chartmogul.com/blog/chat-with-your-revenue-data/
Jun 16, 2025 - AI is quickly becoming the new interface of the internet, not just for finding information, but for getting things done. So what if you could also chat with...
mcp serverchatrevenuedatachartmogul
https://ui.shadcn.com/docs/mcp
Use the shadcn MCP server to browse, search, and install components from registries.
mcp servershadcnui
https://apimcp.dev/
Transform any REST API into AI-agent ready MCP servers. No code required - connect your APIs to Claude, ChatGPT, and other AI agents in minutes.
mcp serverdevtransformapiai
https://mcpservers.com/servers/lishenxydlgzs-aws-athena
Integrates with AWS SDK to execute SQL queries against Athena databases, enabling large-scale data analysis and business intelligence for AWS data lakes. |...
model context protocolmcp serveraddawsathena
https://www.mcp.pizza/mcp-server/7QfT/mcp-metatrader5-server
MCP server enabling AI-driven trading and market data access on MetaTrader 5.
mcpserverpizza
https://mcpservers.com/servers/mendable-firecrawl-sse
Integration with FireCrawl to provide advanced web scraping capabilities for extracting structured data from complex websites. | Model Context Protocol server...
model context protocolmcp serveraddfirecrawlsse
https://ui.nuxt.com/docs/getting-started/ai/mcp
Use Nuxt UI components in your AI assistants with Model Context Protocol support.
mcp servernuxt ui
https://dxt.so/mcp-server/client/oterm-client
Interact with Ollama models directly from your terminal using a straightforward text-based client.
mcp server
https://dxt.so/mcp-server/client/librechat-client
Self-host a privacy-first, versatile ChatGPT alternative supporting multiple AI models and advanced features.
mcp serverlibrechatdannyavila
https://freedocs.bluerock.io/bluerock-secure-mcp-server-for-fastmcp/access-deployment-and-setup/getting-started-with-bluerock-secure-mcp-server
getting startedmcp serversecurefreetier
https://www.techzine.eu/news/security/130974/salt-security-launches-mcp-server-to-protect-apis/
Apr 29, 2025 - Salt Security introduces MCP Server to improve API security as AI agents increase API traffic. Discover the features and impact.
mcp servertechzine globalsaltsecuritylaunches
https://www.teradata.com/platform/clearscape-analytics/agent-ai
Discover how Teradata AgentBuilder and MCP Server empower enterprises to build, deploy, and manage autonomous AI agents with trusted data, domain expertise,...
agentic aimcp serverenterpriseteradataamp
https://startupfa.me/s/mcp-server-space?utm_source=mcpserver.space
A community-driven directory of Model Context Protocol (MCP) servers and clients. Browse curated lists of latest, featured, and official MCP entries w…
model context protocolmcp serverspacediscoverintegrate
https://mcpservers.com/servers/lolrazh-rayon-design-cad
Integrates with Rayon Design CAD interface using browser automation to enable shape creation and drawing method searches for AI-assisted design workflows. |...
mcp serveraddrayondesigncad
https://dxt.so/mcp-server/security/safeline-mcp
SafeLine - SafeLine is a self-hosted WAF(Web Application Firewall) to protect your web apps from attacks and exploits.
mcp server
https://wpengine.com/builders/smart-search-ai-model-context-protocol-mcp-server/
Dec 11, 2025 - The Smart Search AI Model Context Protocol (MCP) Server by WP Engine is a special component that runs as part of the Smart Search AI service. When you enable...
model context protocolsmart searchunderstandingwpai
https://saviynt.com/blog/introducing-saviynt-mcp-server-faster-smarter-identity-security
Saviynt MCP Server enables natural language identity management through LLM applications for streamlined access control and provisioning.
mcp serveridentity securitysaviyntintroducesfirst
https://www.composer.trade/blog/introducing-the-composer-mcp-server
Aug 13, 2025 - The Composer MCP gives LLMs the power to backtest investment ideas and execute trading strategies. Trade across stocks, ETFs, and crypto directly in Claude.
mcp serverintroducingcomposer
https://dataworks.variflight.com/blog/flight-mcp-server-in-ai-chatbots-integrating-flight-alerts
Discover how the Flight MCP Server uses Flight Alert APIs with AI chatbots. It also connects to smart customer service systems. This helps provide timely a
mcp serverai chatbotsflightintegratingalerts
https://dxt.so/mcp-server/developer-tools/nx-mcp
Nx - Makes Nx's understanding of your codebase accessible to LLMs, providing insights into the codebase architecture, project relationships and runnable...
mcp servernx
https://ai-sdk.dev/elements/mcp
AI Elements supports the Model Context Protocol (MCP) for model-driven development.
mcp server
https://affise.com/blog/affise-is-bringing-ai-to-performance-marketing/
Oct 8, 2025 - Discover how Affise uses AI in performance marketing to automate optimization, enhance targeting, and boost ROI with data‑driven insights.
performance marketingmcp serveraiaffiselaunches
https://www.csoonline.com/article/4093704/tools-um-mcp-server-abzusichern.html
Dec 9, 2025 - MCP-Server einzusetzen, liegt im Trend – und birgt Risiken. Diesen begegnen Sie mit den richtigen Tools.
mcp servercso onlinetoolsum
https://community.netwrix.com/t/introducing-new-privilege-secure-mcp-server/109899
Empower AI to help you monitor, manage, and audit privileged access with live context We are pleased to introduce the initial release of the Netwrix Privilege...
mcp serverintroducingnewprivilegesecure
https://mcpservers.com/servers/openai-deepwiki-mcp-sse
DeepWiki provides up-to-date documentation you can talk to, for every repo in the world. Think Deep Research for GitHub. | Model Context Protocol server for AI...
model context protocoladddeepwikimcpsse
https://www.dremio.com/blog/using-the-dremio-mcp-server-with-any-llm-model/
Sep 29, 2025 - See how Dremio’s Universal MCP Chat Client lets you swap GPT, Claude, Gemini or Cohere while connecting to the same ecosystem of tools.
mcp serverusingdremiollmmodel
https://mcpservers.com/clients/cursor
AI-powered code editor with smart completion and refactoring tools.
model context protocolmcp serverscursor
https://mcpservers.com/servers/junmer-lottiefiles
Integrates with the LottieFiles API to enable search and retrieval of animations by keywords, popular collections, and detailed information without leaving the...
model context protocolmcp serveraddlottiefilesservers
https://mcpservers.com/servers/liujilongobject-mcp-host-cli
Command-line tool for creating and managing MCP hosts with streamlined setup for developers integrating AI capabilities into applications. | Model Context...
model context protocoladdmcphostcli
https://dxt.so/mcp-server/code-execution/run-python-mcp
Executes Python code in a secure, sandboxed environment using an MCP server.
mcp serverrunpythonpydantic
https://sdtimes.com/ai/this-week-in-ai-updates-gpt-5-1-cloudsmith-mcp-server-and-more-november-14-2025/
Nov 14, 2025 - Software Development News
weekaiupdatesgptcloudsmith
https://dev.to/arjuncodess/introducing-the-storyblok-mcp-server-1cdd
Jun 14, 2025 - This is a submission for the Storyblok Challenge Introduction I've always hated boring... Tagged with devchallenge, storyblokchallenge, mcp, api.
mcp serverintroducingstorybloktalkcms
https://mcpservers.com/servers/liuwanglei-tal-nasa-astronomy-picture-of-the-day
Integrates with NASA's Astronomy Picture of the Day API to retrieve daily space images and descriptions directly within the Cursor IDE development...
mcp serveraddnasaastronomypicture
https://www.gravitee.io/blog/turn-any-rest-api-into-mcp-server-inside-gravitee
Learn how to turn any REST API into an AI-ready tool using Gravitee’s MCP Tool Server. In this hands-on guide, we'll take a real API, run it through...
rest apimcp serverturninsidegravitee
https://dxt.so/mcp-server/client/chatmcp-client
Interact with AI models using the Model Context Protocol through a cross-platform chat client.
mcp server
https://mobisoftinfotech.com/resources/blog/ai-development/ai-agent-development-custom-mcp-server-code-review
Oct 17, 2025 - Learn how to build an AI-powered code review agent with a custom MCP server in this step-by-step guide. Part I covers the core development process.
ai agent developmentmcp serverexamplecustompart
https://glucn.com/posts/2025-05-17-my-first-mcp-server
A quick guide to building your first MCP server in Typescript - create a DNS query tool and connect it to Claude Desktop app for real-time AI interaction.
mcp servercombuildingfirstdns
https://ui.shadcn.com/docs/registry/mcp
MCP support for registry developers
mcp servershadcnui
https://kube.fm/groundcover-announces-mcp-server-deep-observability
mcp servergroundcoverannouncesperformdeep
https://www.perforce.com/blog/pdx/delphix-mcp-server-test-data-management
The Delphix MCP Server connects AI to test data, enabling smarter test data management, compliance automation, and developer self-service. Learn how it works.
test datamcp servertalkdelphix
https://justrunmy.app/mcp
Deploy containers from Cursor or VS Code via the Model Context Protocol (MCP) server. Create apps, map ports, set env, view logs in your IDE. Free tier...
vs codemcp serverdeploycontainerscursor
https://chakra-ui.com/docs/get-started/ai/mcp-server
Bridging the gap between AI agents and Chakra UI
mcp serverchakra ui
https://render.com/docs/mcp-server
mcp serverrenderdocs
https://mcpservers.com/servers/lowlyocean-duckduckgo-search
Integrates with DuckDuckGo to enable web search functionality, returning results as structured data for easy incorporation into AI workflows. | Model Context...
model context protocolmcp serveraddduckduckgosearch
https://www.infoworld.com/article/4095551/angular-v21-debuts-signal-forms-stabilizes-mcp-server.html
Nov 24, 2025 - Signal Forms is an experimental library that allows developers to manage form state by building on Angular’s reactive signals system.
mcp serverangulardebutssignalforms
https://mcpservers.com/servers/revit-mcp-revit
Enables AI interaction with Autodesk Revit models through a Node.js server that provides tools for creating, modifying, and deleting BIM objects in...
model context protocolmcp serveraddrevitservers
https://www.trendmicro.com/en_us/research/25/f/why-a-classic-mcp-server-vulnerability-can-undermine-your-entire-ai-agent.html
A single SQL injection bug in Anthropic’s SQLite MCP server—forked over 5,000 times—can seed stored prompts, exfiltrate data, and hand attackers the keys...
mcp serverclassicvulnerabilityundermineentire
https://www.agoda.com/press/agoda-launches-open-source-api-agent-to-simplify-mcp-server-integrations/
Jan 29, 2026 - Singapore, January 29, 2026 — Digital travel platform Agoda today announced the open-source release of its API Agent, a universal Model Context Protocol (MCP)...
open sourcemcp serveragodalaunchesapi
https://mcpservers.com/servers/lorrylockie-lark
Provides a bridge to Lark/Feishu workplace collaboration platform, enabling access to employee information and messaging capabilities with automatic...
model context protocolmcp serveraddlarkservers
https://blog.soracom.com/ja-jp/2025/07/16/soracom-mcp-server/
Jul 16, 2025 - こんにちは、ソラコムのエンジニアリングマネージャー兼バックエンドエンジニアの中西(ニックネーム: kaz)です。...
mcp serversoracomapi
https://www.epicai.pro/your-open-api-implementation-is-not-an-mcp-server-ss1ue
Wrapping OpenAPI implementation as MCP tools isn’t enough. Design workflow-based tools that guide LLMs like a UI would guide a human for better results.
mcp serveropenapiimplementation
https://www.gopherguides.com/articles/mcp-server-new-tiers-teams
Gopher Guides MCP server adds new pricing tiers for teams and enterprises, plus two new tools for explaining Go idioms and suggesting refactoring improvements....
mcp servergoespronewtiers
https://mcpservers.com/servers/highlight-ing-youtube-transcript-extractor
Extracts transcripts from YouTube videos using various URL formats, enabling automated content analysis and summarization. | Model Context Protocol server for...
mcp serveraddyoutubetranscriptextractor
https://linear.app/docs/mcp
This guide is intended to give you an overview of Linear's features, discover their flexibility, and provide tips for how to use Linear to improve the...
mcp serverlineardocs
https://www.postman.com/product/mcp-server/
Postman's remote MCP server allows your IDE or AI agents to manage your API workflows across Postman workspaces, collections, specs, and more.
mcp serverai agentspostmanremoteconnect
https://mcpservers.com/servers/localsummer-dify-workflow
Integrates with Dify to enable text generation, data analysis, and conversational flow management through Dify's API, streamlining AI-powered application...
model context protocolmcp serveradddifyworkflow
https://mariadb.com/docs/release-notes/mcp-server-release-notes
mcp serverrelease notesmariadb documentation
https://laravel-news.com/nightwatch-mcp
Feb 17, 2026 - Laravel Nightwatch MCP is now live, enabling developers to diagnose and resolve application issues using AI agents like Claude Code. Learn how to install and...
laravel releasesmcp serverclaude codenightwatchai
https://dxt.so/mcp-server/client/zed-client
Edit code with high performance and multiplayer collaboration.
mcp serverzedindustries
https://windsurf.com/university/tutorials/configuring-first-mcp-server
Learn how to extend Cascade with external tools and data sources using MCP
mcp serverconfiguringfirst
https://mcpservers.com/servers/neon-neon-sse
Manage Neon's serverless Postgres databases. | Model Context Protocol server for AI integration and automation.
model context protocolmcp serveraddneonsse
https://guides.getalby.com/user-guide/alby-bitcoin-payments-mcp-server/
mcp serveralbybitcoinpaymentsguides
https://dxt.so/mcp-server/coding-agents/github-mcp
Enables advanced automation and interaction capabilities with GitHub APIs for developers and tools using the Model Context Protocol.
github mcp server
https://dxt.so/mcp-server/coding-agents/context7-mcp
Fetches up-to-date documentation and code examples for LLMs and AI code editors directly from the source.
mcp server
https://mcpservers.com/servers/qpd-v-mcp-communicator-telegram
An MCP server that enables communication with users through Telegram. This server provides a tool to ask questions to users and receive their responses via a...
model context protocoladdmcpcommunicatortelegram
https://dxt.so/mcp-server/client/cline-client
Automates coding tasks directly within your IDE using AI, capable of creating/editing files, executing commands, and using the browser with user permission.
mcp servercline
https://mcpservers.com/servers/agentdeskai-browser-tools
Enables web browsing capabilities through tools for content extraction, link following, and browser automation with customizable parameters for scraping, data...
model context protocolbrowser toolsmcp serveraddservers
https://massive.com/blog/querying-financial-markets-with-the-polgon-io-mcp-server-claude-4-and-pydantic-ai
Nov 3, 2025 - Learn how to use Massive's MCP server inside of a Pydantic AI agentic workflow, alongside Anthropic's Claude 4 and the Rich Python library.
financial marketsmcp serverqueryingmassivecom
https://www.algolia.com/developers/lp-mcp
Use the Algolia MCP Server to retrieve, add, or update data in your Algolia index configuration.
mcp serveralgolia
https://dxt.so/mcp-server/client/goose-client
Automates complex development tasks using an extensible, open-source AI agent.
mcp servergooseblock
https://docs.4everland.org/hositng/hosting-mcp-server
mcp serverhostingdocuments
https://mcpservers.com/servers/lmcmz-flow-blockchain
Integrates with the Flow blockchain to enable direct querying of account balances, domain resolution, and transaction execution through RPC communication for...
model context protocolmcp serveraddflowblockchain
https://dxt.so/mcp-server/client/mcp-client-cli-client
Enables interaction with LLMs and MCP-compatible servers from the command line.
mcp clientserver
https://dxt.so/mcp-server/developer-tools/llmware-mcp
Provides a unified framework for building enterprise Retrieval-Augmented Generation (RAG) pipelines with small, specialized models.
mcp server
https://developers.googleblog.com/introducing-the-developer-knowledge-api-and-mcp-server/
Announcing the Developer Knowledge API and MCP server in public preview. Connect your AI tools and agents directly to official Google documentation for...
mcp servergoogle developersintroducingknowledgeapi
https://www.dotsource.de/leistungen/ki-und-prozessautomatisierung/mcp-agentur/
Machen Sie Ihre KI handlungsfähig. Als MCP-Agentur entwickeln & hosten wir Ihren MCP-Server und binden Ihre Systeme DSGVO-konform an.
mcp serveragenturintegrationhostingdeine
https://mcpservers.com/servers/lucas-deangelis-arangodb
Integrates ArangoDB databases into workflows, enabling dynamic querying and analysis of document-oriented and graph data via AQL and document retrieval. |...
model context protocolmcp serveraddservers
https://mcpservers.com/servers/useshortcut-mcp-server-shortcut
The MCP server for Shortcut | Model Context Protocol server for AI integration and automation.
model context protocolmcp serveraddshortcutservers
https://mcpservers.com/servers/lochgeo-kubernetes
Integrates with Kubernetes clusters to enable direct pod, deployment, and service management operations through specialized FastMCP tools, eliminating the need...
model context protocolmcp serveraddkubernetesservers
https://mcpservers.com/servers/longjianjiang-mermaid
Provides a bridge to mermaid.js for generating flowcharts, sequence diagrams, and other visualizations through natural language | Model Context Protocol server...
model context protocolmcp serveraddmermaidservers
https://mcpservers.com/servers/lobstercare-geofs-flight-simulator
Enables natural language control of aircraft in the GeoFS flight simulator through a WebSocket server that translates commands into simulator actions for...
flight simulatormcp serveraddserversmodel
https://cmotech.uk/story/umbraco-appoints-phil-whittaker-to-lead-ai-mcp-server-work
Umbraco has appointed Phil Whittaker as Staff Engineer (AI) to lead MCP Server development, enhancing AI integration and control within its CMS platform.
lead aimcp serverumbracophilwhittaker