Robuta

https://parasiteswithoutborders.com/ Education for Parasitic Diseases | Parasites Without Borders A comprehensive, advanced educational resource and disseminator of basic and clinical information dealing with all aspects of the global problems associated... parasitic diseaseseducationparasiteswithoutborders https://collections.nlm.nih.gov/?f%5Bdrep2.subjectAggregate%5D%5B%5D=Parasitic+Diseases+--+transmission&sort=score+desc Subjects: Parasitic Diseases -- transmission - Digital Collections - National Library of Medicine... parasitic diseasesdigital collectionsnational librarysubjectstransmission https://www.ebsco.com/research-starters/consumer-health/immune-response-parasitic-diseases Immune response to parasitic diseases | Consumer Health | Research Starters | EBSCO Research immune responseparasitic diseasesconsumer healthresearchstarters https://cy.wiktionary.org/wiki/parasitic parasitic - Wiciadur parasiticwiciadur https://treefruit.wsu.edu/crop-protection/nematodes-2/ Plant-Parasitic Nematodes in Pome and Stone Fruit Orchards | WSU Tree Fruit | Washington State... https://repository.si.edu/items/7fc80558-7df6-456f-8044-1be0200d5fc0 A new parasitic mollusk of the genus IEulima/I a newof theparasiticmolluskgenus https://hydra.bio.ed.ac.uk/privacy Privacy | Parasitic Helminths: New Perspectives in Biology and Infection new perspectivesprivacyparasiticbiologyinfection https://nursing.ucalgary.ca/news/collaborative-research-identifies-new-more-environmentally-friendly-drug-class-targeting-parasitic Collaborative research identifies new, more environmentally friendly drug class targeting parasitic... University of Calgary researchers contribute to multidisciplinary study recently published in the journal Nature collaborative researchenvironmentally friendlyidentifiesnew https://gnovisjournal.georgetown.edu/the-gnovis-blog/maybe-the-blogosphere-is-parasitic/ Maybe the Blogosphere is parasitic? | Gnovis Journal | Georgetown University Feb 3, 2009 - Thank heavens the election is finally over and we can all go back to debating if newspapers are going to "make it" in this new, open, and tech-heavy... the blogospheremaybeparasiticgnovisjournal https://pure.psu.edu/en/publications/how-will-public-and-animal-health-interventions-drive-life-histor/ How will public and animal health interventions drive life-history evolution in parasitic... https://www.icm.csic.es/ca/projects/understanding-top-down-control-coastal-bloom-forming-protists-opening-parasitic UNDERSTANDING TOP-DOWN CONTROL IN COASTAL BLOOM-FORMING PROTISTS: OPENING THE PARASITIC COMPARTMENT... https://amsdottorato.unibo.it/id/eprint/8939/ Epidemiology, Control and Public Health aspects of parasitic diseases public healthepidemiologycontrolaspectsparasitic https://elp.tamu.edu/ipm/bugs/order-diptera-flies/family-tachinidae/diptera-tachinidae-zaira-parasitic-flies-k-2/ Diptera-Tachinidae-Zaira-Parasitic Flies (K) - Urban Programs - El Paso County el pasodipteratachinidaezairaparasitic https://repository.si.edu/items/21364d39-ee1e-4324-9119-dafb3b5e6209/full Synonymical and descriptive notes on parasitic Hymenoptera notes ondescriptiveparasitichymenoptera https://irp.nih.gov/news-and-events/in-the-news/emerging-parasitic-disease-mimics-the-symptoms-of-visceral-leishmaniasis-in Emerging parasitic disease mimics the symptoms of visceral leishmaniasis in people | NIH Intramural... https://media.ed.ac.uk/media/1a+Introduction+and+Parasitic+Fungi/1_gwhjxyde 1a Introduction and Parasitic Fungi - Media Hopper Create The Green Planet field course parasitic fungiintroductionmediahoppercreate https://pubchem.ncbi.nlm.nih.gov/patent/EP-1201952-B1 Synchronizer with reduced parasitic friction - Patent EP-1201952-B1 - PubChem EP-1201952-B1 chemical patent summary. synchronizerreducedparasiticfrictionpatent https://arizonabeetlesbugsbirdsandmore.blogspot.com/2019/05/a-tethered-ladybug.html Arizona: Beetles, Bugs, Birds and more: A tethered Ladybug, a parasitic wasp and a virus Hippodamia convergens tethered above pupae of parasitic wasp Dinocampus coccinellae I found this below Snow Bowl in Flagstaff, Arizona: ... birds and more https://ceqanet.lci.ca.gov/2025101397/2 Heber 1 Parasitic Solar Energy Project 2025101397 - 2026-01-27 - EIR - Heber 1 Parasitic Solar Energy Project solar energyheberparasiticproject https://research.ibm.com/publications/a-novel-ald-sibcn-low-k-spacer-for-parasitic-capacitance-reduction-in-finfets A novel ALD SiBCN low-k spacer for parasitic capacitance reduction in FinFETs for VLSI Technology... A novel ALD SiBCN low-k spacer for parasitic capacitance reduction in FinFETs for VLSI Technology 2015 by Tenko Yamashita et al. https://webinars.sw.siemens.com/pt-PT/parasitic-extraction-with-high-accuracy-and-performance/ Parasitic Extraction with high accuracy & performance India | Siemens high accuracyparasiticextractionperformanceindia https://bagimnadav.weebly.com/aphids--parasitic-wasps.html Aphids & Parasitic wasps - NADAV BAGIM PHOTOGRAPHY A documented parasitic wasp injecting it's egg inside an Aphid. The egg hatches into a larva that lives inside the aphid while feeding from it's internal... parasitic waspsaphidsphotography https://elp.tamu.edu/ipm/bugs/family-orussidae/hymenoptera-orussidae-kulcania-tomentosa-parasitic-wood-wasps-female-j/ Hymenoptera-Orussidae-Kulcania tomentosa-Parasitic Wood Wasps FEMALE (J) - Urban Programs - El Paso... https://rajeev2004.blogspot.com/2012/05/my-rediff-piece-on-how-to-rescue-rupee.html Shadow Warrior: my rediff piece on how to rescue the #rupee. basically, tighten belts of parasitic... http://www.rediff.com/business/column/rescuing-the-rupee-what-can-be-done/20120525.htm with admirable restraint, even if i say so myself, i ... https://www.popsci.com/environment/parasitic-crickets-ant-colonies/ Parasitic crickets have a few moves to outsmart ants | Popular Science Infiltrating ant colonies comes with a deadly risk. a fewparasiticcrickets https://ucalgary.ca/news/collaborative-research-identifies-new-more-environmentally-friendly-drug-class-targeting-parasitic Collaborative research identifies new, more environmentally friendly drug class targeting parasitic... University of Calgary researchers contribute to multidisciplinary study recently published in the journal Nature collaborative researchenvironmentally friendlyidentifiesnew https://www.siemens.com/en-us/products/ic/calibre-design/circuit-verification/xact-3d/ Calibre xACT 3D Parasitic Extraction | Siemens Calibre xACT 3D field-solver technology delivers multi-threaded and distributed processing for fast, scalable parasitic extraction. calibrexactparasiticextractionsiemens https://repository.lsu.edu/plantcrop_pubs/426/ "Plant-parasitic nematodes associated with the root zone of hop cultiva" by Tristan T. Watson,... In early 2016, hop plants were introduced into Florida. By late 2016, the hop plants were showing stunted growth and were heavily parasitized by Meloidogyne... https://elp.tamu.edu/ipm/bugs/order-diptera-flies/family-tachinidae/diptera-tachinidae-paradidyma-singularis-parasitic-flies-female-g/ Diptera-Tachinidae-Paradidyma singularis-Parasitic Flies FEMALE (G) - Urban Programs - El Paso... Jan 8, 2019 - Paradidyma singularis https://mbd-db.osu.edu/hol/publications/ad1a336d-5a8d-4820-83f4-cebd3f2bfc14?filters%5Bfilter_options%5D%5B%5D=4880cd2b-8bbb-4a61-a7a4-a9e0d46b9121&search_type=fast Article: Behavioral notes and redescription of the socially parasitic ant Myrmica luteola... of the https://scholarworks.umass.edu/entities/publication/31b17678-a92f-47fd-be65-5b62d55b5dd1 Tough Parasitic Gaps toughparasiticgaps https://webarchive.library.unt.edu/eot2008/20090121013448mp_/http:/www.cdc.gov/ncidod/dpd/parasites/listing.htm Division of Parasitic Diseases - Alphabetical Listing division ofparasitic diseasesalphabeticallisting https://pmc.ncbi.nlm.nih.gov/articles/PMC8314824/ Parasitic Disease Surveillance, Mississippi, USA - PMC Surveillance for soil-transmitted helminths, strongyloidiasis, cryptosporidiosis, and giardiasis was conducted in Mississippi, USA. PCR performed on 224 fecal... disease surveillanceparasiticmississippiusapmc https://hortsense.cahnrs.wsu.edu/fact-sheet/parasitic-wasps-ichneumonid-and-braconid-wasps/ Parasitic Wasps : Ichneumonid and braconid wasps | Hortsense | Washington State University parasitic waspswashington stateuniversity https://webarchive.library.unt.edu/eot2008/20090506211617mp_/http:/www.cdc.gov/ncidod/dpd/parasites/index.htm A-Z Index of Parasitic Diseases | CDC DPD parasitic diseases a to z listing a zindex ofparasitic diseasescdcdpd https://www.mdpi.com/1424-8220/20/24/7002 A Novel Broadband Monopole Antenna with T-Slot, CB-CPW, Parasitic Stripe and Heart-Shaped Slice for... This paper presents a novel broadband monopole antenna that was equipped with a bottom semicircle ground structure, a parasitic patch, a T-shaped slot, s... https://www.mathworks.com/help/antenna/ug/wideband-cellular-basestation-antenna.html Design Wideband Cellular Base Station Antenna with Parasitic Elements - MATLAB & Simulink Design a custom antenna with parasitic elements to enhance its directivity and bandwidth for cellular base station applications. cellular base stationdesignwideband https://radio.foxnews.com/2020/10/21/the-parasitic-mind-with-dr-gad-saad/ The Parasitic Mind with Dr. Gad Saad | Gutfeld! Monologues Oct 21, 2020 - This week, Greg is joined by Dr. Gad Saad who is a Professor of Marketing at Concordia University to discuss his new book, "The Parasitic Mind: How Infectious... gad saadparasiticminddrgutfeld https://hydra.bio.ed.ac.uk/hydra-greece-5-10-september-2010 Hydra, Greece, 5-10 September 2010 | Parasitic Helminths: New Perspectives in Biology and Infection https://uglyoverload.blogspot.com/2009/07/parasitic-harbinger-of-good-news.html?showComment=1246515368526 Ugly Overload: Parasitic Harbinger of Good News It's often all a matter of perspective and context. If I were taking a pleasure stroll along one of my favorite waterways and stumbled acros... uglyoverloadparasiticharbingergood https://nas.er.usgs.gov/queries/CollectionInfo.aspx?SpeciesID=2770 a parasitic barnacle - Collections parasiticbarnaclecollections https://profiles.nlm.nih.gov/spotlight/bb/catalog/nlm:nlmuid-101584906X12089-doc The Laboratory of Chemotherapy for Parasitic Diseases - Joshua Lederberg - Profiles in Science the laboratoryparasitic diseases https://theragblog.blogspot.com/2012/10/ideas-bill-meacham-is-religion.html The Rag Blog: IDEAS / Bill Meacham : Is Religion a Parasitic Meme or a Helpful Adaptation? Moai at Easter Island. Moai are the living faces of deified ancestors. Image from Wikimedia Commons. Religion: Parasitic meme or hel... the rag blog https://research.ibm.com/publications/dual-mode-parasitic-bipolar-effect-in-dynamic-cvsl-xor-circuit-with-floating-body-partially-depleted-soi-devices Dual-mode parasitic bipolar effect in dynamic CVSL XOR circuit with floating-body partially... Dual-mode parasitic bipolar effect in dynamic CVSL XOR circuit with floating-body partially depleted SOI devices for International Journal of Electronics by... https://www.livescience.com/health/surgery/surgeons-remove-parasitic-twin-from-teenager-who-had-legs-growing-out-of-his-chest Surgeons remove parasitic twin from teenager who had legs growing out of his chest | Live Science Feb 26, 2025 - A rare parasitic twin protruding from the chest of a 17-year-old boy has been removed by surgeons in Delhi, India. https://researchportalplus.anu.edu.au/en/publications/learned-recognition-of-brood-parasitic-cuckoos-in-the-superb-fair/ Learned recognition of brood parasitic cuckoos in the superb fairy-wren Malurus cyaneus - The... https://research.ibm.com/publications/dual-mode-parasitic-bipolar-effect-in-dynamic-cvsl-xor-circuit-with-floating-body-partially-depleted-soi-devices--1 Dual-mode parasitic bipolar effect in dynamic CVSL XOR circuit with floating-body... Dual-mode parasitic bipolar effect in dynamic CVSL XOR circuit with floating-body partially-depleted SOI devices for VLSI-TSA 1997 by C.T. Chuang et al. https://pmc.ncbi.nlm.nih.gov/articles/PMC9481011/ Phylogeny and taxonomy of Haloclavidae (Verrill, 1899) with a redescription of the parasitic,... Haloclavidae Verrill, 1899 is a family of burrowing sea anemones grouped within the superfamily Actinioidea (Rafinesque, 1815). Currently, it includes 30... https://gateway.euro.who.int/en/indicators/hfamdb_393-sdr-1-19-infectious-and-parasitic-diseases-per-100-000/ SDR(1-19), Infectious and parasitic diseases, per 100 000 - European Health Information Gateway Indicator: Infectious and parasitic diseases, 1-19 years, per 100 000 population, by sex (age-standardized death rate), Categories: All causes of death and... https://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2022.791488/full Frontiers | Neuroimmunology of Common Parasitic Infections in Africa Parasitic infections of the central nervous system are an important cause of morbidity and mortality in Africa. The neurological, cognitive, and psychiatric ... parasitic infectionsfrontiersneuroimmunologycommonafrica https://ohioline.osu.edu/factsheet/plpath-gen-9 Parasitic Higher Plants | Ohioline This is the ninth fact sheet in a series of ten designed to provide an overview of key concepts in plant pathology. Plant pathology is the study of plant... parasitichigherplants https://apitherapy.blogspot.com/2021/08/honey-bee-products-show-anti-cancer.html?m=0 Apitherapy News: Honey Bee Products Show Anti-Cancer, Anti-Bacterial, Anti-Viral, Anti-Parasitic... Apitherapy News: The Internet's best source of information about the medicinal use of honey, bee pollen, propolis, beeswax, bee venom, and royal jelly honey bee productsanti cancerapitherapynews https://publica.fraunhofer.de/entities/publication/9cfeb4b8-3a62-477a-8619-7ff0622f8666 Comparative characterization of two galectins excreted-secreted from intestine-dwelling parasitic... Helminths are complex pathogens that ensure their long-term survival by influencing the immune responses of their host. Excretory/secretory products (ESP) can... comparativecharacterizationtwo https://www.popsci.com/environment/stink-bug-fungus-wasps/ These stink bugs use cordycep-like fungus to fend off parasitic wasps | Popular Science The special glands located on their legs were first mistaken for 'ears.' https://journals.plos.org/plosone/article?id=10.1371%2Fjournal.pone.0135103 Host Specificity in the Honeybee Parasitic Mite, Varroa spp. in Apis mellifera and Apis cerana |... The ectoparasitic mite Varroa destructor is a major global threat to the Western honeybee Apis mellifera. This mite was originally a parasite of A. cerana in... https://www.kcur.org/health/2026-07-15/missouri-cyclospora-cases-diarrhea-parasite Missouri reports 43 cases of parasitic infection that's sickened thousands nationwide | KCUR -... Jul 29, 2026 - Missouri still has far fewer reported cases of cyclospora, the parasitic infection than other Midwest states. Cylosporiasis symptoms include nausea and watery... https://boris-portal.unibe.ch/entities/publication/0e9cf48c-14c5-4f64-99d5-6f1a3de90c06 Bumped Kinase Inhibitors as therapy for apicomplexan parasitic diseases: lessons learned. Bumped Kinase Inhibitors, targeting Calcium-dependent Protein Kinase 1 in apicomplexan parasites with a glycine gatekeeper, are promising new therapeutics for... kinase inhibitorsparasitic diseasesbumpedtherapy https://www.ub.edu/irbio/predoctoral-contract-photoprotection-mechanisms-in-parasitic-plants-o-63-en Predoctoral Contract: Photoprotection Mechanisms in Parasitic Plants contractphotoprotectionmechanismsparasiticplants https://www.frontiersin.org/journals/pharmacology/articles/10.3389/fphar.2023.1320062/full Frontiers | Unlocking the hepatoprotective potential of the parasitic plant Orobanche foetida Poir.... In this current study, we explored the preventive capacity of the aqueous extract of Orobanche foetida (OF), a root holoparasite, against CCl4 prompt hepatot... frontiersunlockinghepatoprotectivepotential https://www.healthychildren.org/English/health-issues/conditions/treatments/Pages/Tips-For-Treating-Viruses-Fungi-and-Parasites.aspx Preventing and Treating Infections in Kids: Viral, Bacterial, Parasitic & Fungal -... Every person encounters infectious organisms throughout the day in the air, in soil and water, in foods, and on surfaces everywhere. Le​arn how vaccines,... in kidspreventingtreatinginfectionsviral https://emploi.cnrs.fr/Offres/CDD/UMR8587-JUAPEL-001/Default.aspx?lang=EN Portail Emploi CNRS - Job offer - Electrical detection of parasitic species produced by batteries... https://nla.gov.au/nla.obj-2769148190/view Parasitic Infusoria From Macquarie Island parasiticmacquarieisland https://research.wur.nl/en/publications/secreted-venom-allergen-like-proteins-of-plant-parasitic-nematode-3/ Secreted venom allergen-like proteins of plant-parasitic nematodes modulate defence responses in... https://extension.colostate.edu/resource/insect-parasitic-nematodes/ Insect Parasitic Nematodes | CSU Extension Sep 2, 2025 - Insect parasitic nematodes - small round worms that kill insects but are harmless to other organisms - may be used to control pests. Learn more. insectparasiticnematodescsuextension https://elp.tamu.edu/ipm/bugs/order-diptera-flies/family-tachinidae/diptera-tachinidae-xanthomelanodes-arcuatus-parasitic-flies-e/ Diptera-Tachinidae-Xanthomelanodes arcuatus-Parasitic Flies (E) - Urban Programs - El Paso County May 7, 2024 - Xanthomelanodes arcuatus https://repository.si.edu/items/dfb69c36-03a4-44ed-9777-a4974b063d83 Descriptions of two new species of Strepsiptera parasitic on sugar cane insects new speciessugar canedescriptionstwo https://biology.unm.edu/news-events/seminars/detail/20260312_paulo.html The Good, the Bad and the Ugly: Mysterious tales of parasitic flies :: Department of Biology | The... the good https://elp.tamu.edu/ipm/bugs/order-diptera-flies/family-tachinidae/diptera-tachinidae-peleteria-subgenus-sphyrimyia-parasitic-flies-f/ Diptera-Tachinidae-Peleteria subgenus Sphyrimyia-Parasitic Flies (F) - Urban Programs - El Paso... Dec 28, 2025 - Peleteria subgenus Sphyrimyia https://research.tue.nl/en/activities/parasitic-effects-from-cooling-of-gan-power-transistors/ Parasitic Effects from Cooling of GaN Power Transistors - Research portal Eindhoven University of... gan power transistors https://research.wur.nl/en/publications/rhamphicarpa-fistulosa-a-parasitic-weed-threatening-rain-fed-lowl/ Rhamphicarpa fistulosa, a parasitic weed threatening rain-fed lowland rice production in... https://aggiecollaborate.tamu.edu/molecular-detection-and-co-infection-studies-of-parasitic-helminth-and-tick-borne-pathogens-in-ticks/ Molecular detection and co-infection studies of parasitic helminth and tick-borne pathogens in... https://cordis.europa.eu/article/id/29444-monarch-butterflies-give-clue-to-parasitic-dilemma Monarch butterflies give clue to parasitic dilemma | News | CORDIS | European Commission Scientists studying monarch butterflies have uncovered evidence of how the insects' parasites strike a balance between harming their... monarch butterfliesgiveclue https://daydreamer-theplayground.blogspot.com/2013/04/dvd-review-parasitic-2012.html Independent Flicks: DVD review: Parasitic (2012) A group of friends are trapped inside a nightclub with an unseen terror. Unable to escape, one at a time they fall victim to the ravenous... dvd reviewindependentflicksparasitic https://webinars.sw.siemens.com/pl-PL/parasitic-extraction-with-high-accuracy-and-performance/ Parasitic Extraction with high accuracy & performance India | Siemens high accuracyparasiticextractionperformanceindia https://scholarspace.manoa.hawaii.edu/items/6525e82e-63f5-4fa2-9a37-caa0a7fe6545 Four New Diclidophorids (Monogenoidea) Parasitic on the Gills of Marine Fishes from the Southwest... https://www.istp.cnr.it/research-product/implications-of-parasitic-absorption-of-electron-cyclotron-waves-on-iter-operation-around-half-field/ Implications of parasitic absorption of electron cyclotron waves on ITER operation around... implicationsparasiticabsorptionelectron https://hortsense.cahnrs.wsu.edu/fact-sheet/parasitic-wasps-chalcid-wasps/ Parasitic Wasps : Chalcid wasps | Hortsense | Washington State University parasitic waspswashington stateuniversity https://resources.sw.siemens.com/ja-JP/fact-sheet-calibre-xl/ Parasitic Extraction for Inductance | Siemens Parasitic inductance can cause chip failure if not accounted for in parasitic extraction. parasiticextractioninductancesiemens https://experts.umn.edu/en/publications/why-are-most-rhizobia-beneficial-to-their-plant-hosts-rather-than/fingerprints/?sortBy=alphabetically Why are most rhizobia beneficial to their plant hosts, rather than parasitic? - Fingerprint -... https://pubmed.ncbi.nlm.nih.gov/40556458/ In Vivo Study on the Anti-Parasitic Effect of Omeprazole on Cryptosporidium parvum in Mice Cryptosporidiosis is an important enteric disease, causing diarrhoea and malabsorption similar to Rotavirus and targeting young children and immunocompromised... https://hsrc.himmelfarb.gwu.edu/gwhpubs/1355/ "Tropical parasitic itch in returned travellers and immigrants from end" by T Ju, A Vander Does et... Itch is the most common skin symptom among tropical parasitic diseases (TPD), but there are limited data about its characteristics in these conditions. In... https://scholarspace.manoa.hawaii.edu/items/7fb125f3-4581-4bf5-b116-33086836773e Plant-Parasitic Algae (Chlorophyta: Trentepohliales) in American Samoa A survey conducted between June 2000 and May 2002 on the island of Tutuila, American Samoa, recorded filamentous green algae of the order Trentepohliales... plantparasiticalgaechlorophytaamerican https://meetings-archive.aps.org/mar/2020/d16/9/ Ultrastrong coupling to parasitic modes in superconducting circuits with hyperinductors - DPOLY... Parasitic modes are inevitable in any real-world circuit. The hope of any practical circuit design is that these modes are sufficiently above the frequency band couplingparasiticmodes https://www.usgs.gov/publications/first-record-neoergasilus-japonicus-poecilostomatoida-ergasilidae-a-parasitic-copepod First record of Neoergasilus japonicus (Poecilostomatoida: Ergasilidae), a parasitic copepod new to... The parasitic copepod Neoergasilus japonicus, native to eastern Asia, was first collected from 4 species of fish (fathead minnow, Pimephales promelas;... first record https://recedingrules.blogspot.com/2020/11/parasitic-plums.html Telecanter's Receding Rules: Parasitic Plums If you are wounded in the mysterious underworld you may become infected by a small parasitic tree. These tree sprout from the back and shou... rulesparasiticplums https://pubchem.ncbi.nlm.nih.gov/patent/EP-0629239-B1 Insecticidal toxins from the parasitic wasp bracon hebetor - Patent EP-0629239-B1 - PubChem EP-0629239-B1 chemical patent summary. https://nouvelles.umontreal.ca/en/article/2023/11/10/modelling-the-dynamics-of-animal-migration-and-parasitic-infection Modelling the dynamics of animal migration and parasitic infection - UdeMnouvelles UdeM professor Sandra Binning and her colleagues have developed a predictive model of parasitic infection-related migratory behaviour in different animal... the dynamicsparasitic infectionmodellinganimalmigration https://www.livescience.com/23657-parasitic-wasp-species.html Dozens of New Parasitic Wasp Species Found | Live Science Oct 5, 2012 - Researchers discovered a surprising diversity of a wasp subfamily in South and Central America. parasitic waspdozensnewspeciesfound https://repository.si.edu/items/19e89c20-4252-4a5c-9c7e-b53d6e2135ec Copepod Crustaceans Parasitic on Elasmobranch Fishes of the Hawaiian lslands of thecopepodcrustaceansparasiticfishes https://www.nationalgeographic.com/science/article/parasitic-fly-spotted-in-honeybees-causes-workers-to-abandon-colonies Parasitic fly spotted in honeybees, causes workers to abandon colonies | National Geographic Throughout North America, honeybees are abandoning their hives. The workers are often found dead, some distance away. Meanwhile, the hives are like honeycombed... spotted in https://experts.colorado.edu/display/meshid_C01.610.432 Parasitic Diseases - Intestinal Diseases, Parasitic | CU Experts | CU Boulder parasitic diseasesintestinalcuexpertsboulder https://biblio.ugent.be/publication/8700354 Molecular characterisation of some plant-parasitic nematodes (Nematoda: Tylenchida) from Belgium molecularcharacterisationplant https://fieldreport.caes.uga.edu/news/uga-releases-parasitic-wasp-to-control-invasive-fruit-fly/ UGA releases parasitic wasp to control invasive fruit fly | CAES Field Report Aug 13, 2025 - The Ganaspis brasiliensis wasp is a predator of spotted wing drosophila, a pest that costs fruit producers billions in losses each year. parasitic wasp https://charleshughsmith.blogspot.com/2012/06/do-parasitic-elite-pay-any-taxes.html oftwominds-Charles Hugh Smith: Do the Parasitic Elite Pay Any Taxes? The parasitic financial Elite don't do any "work" in the sense of something beneficial for society, as no voluntary payment for their servic... charles hugh smithdo the https://ojp.gov/library/publications/parasitic-layer-based-reconfigurable-antenna-design-multi-objective Parasitic Layer-Based Reconfigurable Antenna Design by Multi-Objective Optimization | Office of... This article describes the features of a parasitic layer-based multifunctional reconfigurable antenna (MRA) design based on multi-objective genetic algorithm... antenna design https://webarchive.library.unt.edu/eot2008/20090506230346mp_/http:/www.cdc.gov/ncidod/dpd/parasites/angiostrongylus/factsht_angiostrongylus.htm Division of Parasitic Diseases - Angiostrongylus Infection Fact Sheet Learn about Angiostongylus infection and its public health significance. division ofparasitic diseasesinfectionfactsheet https://mbd-db.osu.edu/hol/publications/fd1bd732-a576-4c43-9a02-5ac05ec12c29?filters%5Bfilter_options%5D%5B%5D=56410721-bba5-4281-90fd-d273d4dd281e&search_type=fast Article: The genera of Mutillidae (Hymenoptera) parasitic on tsetse flies (Glossina; Diptera). https://www.merriam-webster.com/sentences/parasitic Examples of 'PARASITIC' in a Sentence | Merriam-Webster 'Parasitic' in a sentence: But for the last six weeks, the anti-parasitic has flown off the shelves. in a sentenceexamples ofparasiticmerriamwebster https://repository.si.edu/items/d99b3c6b-1a56-4da6-96f2-4c2e887f8a34 The North American species of parasitic two-winged flies belonging to the genus IPhorocera/I... the north american https://repository.lsu.edu/gradschool_theses/2643/ "The use of Duddingtonia flagrans for gastrointestinal parasitic nemato" by Jenna Terry Gastrointestinal nematodes (GIN) are parasites of major concern for domestic and exotic ruminant species around the world. In the past, zoological facilities... the use