https://www.wired.com/story/leak-exposes-members-of-peter-thiels-secretive-dialog-society/
Leak Exposes Members of Peter Thiel’s Secretive ‘Dialog’ Society | WIRED
Jun 16, 2026 - More than 200 of the world's elites registered for a retreat whose agenda runs from panels on cult-building and sex to prepping for World War III. An...
members ofleakexposespetersecretive
https://www.cbsnews.com/news/deaths-disappearances-scientists-staff-government-labs/
FBI investigating deaths and disappearances of staff at secretive government laboratories. Here's...
The disappearances and deaths of 10 government workers tied to nuclear or space technology have sparked speculation online. President Trump said the cases are...
https://www.eff.org/deeplinks/2020/06/inside-invasive-secretive-bossware-tracking-workers
Inside the Invasive, Secretive “Bossware” Tracking Workers | Electronic Frontier Foundation
COVID-19 has pushed millions of people to work from home, and a flock of companies offering software for tracking workers has swooped in to pitch their...
inside theinvasivesecretivetrackingworkers
https://netzpolitik.org/2019/facebook-and-airbus-hold-secretive-drone-tests-in-the-australian-bush/
Facebook and Airbus hold secretive drone tests in the Australian bush - netzpolitik.org
Jan 21, 2019 - The social network company killed its own Aquila drone programme last year. But Facebook has not quit plans to spread internet across the globe. We publish a...
https://thechroniclesoforange.blogspot.com/2010/02/primas-being-all-secretive-and-stuff.html
The Chronicles of Orange: PRIMA's being all secretive and stuff!
apparently Prima has some BIG news! they can't quite share it YET, so we'll have to watch for their big announcement! Prima says... "we ha...
the chroniclesorangeprima
https://www.newswire.ca/news-releases/canadas-most-secretive-local-government-agency-toronto-hydro-652808093.html
Canada's most secretive local government agency: Toronto Hydro
/CNW/ - Toronto Hydro is the 2017 recipient of the Code of Silence Award for Outstanding Achievement in Government Secrecy in the category of local...
local governmentcanadasecretiveagencytoronto
https://isthebbcbiased.blogspot.com/2014/07/the-secretive-bbc.html
Is the BBC biased?: The secretive BBC
For those of us who have watched the BBC's relentless use of legal loopholes to weasel their way out of releasing the Balen Report, thi...
the bbcbiasedsecretive
https://dec.ny.gov/nature/animals-fish-plants/biodiversity-species-conservation/secretive-marsh-birds
Secretive Marsh Birds - NYSDEC
marsh birdssecretivenysdec
https://www.macrumors.com/2016/04/25/inside-pegatron-secretive-iphone-assembly-plant/
First Look Inside Pegatron's Secretive Shanghai iPhone Assembly Plant - MacRumors
Bloomberg has been granted an exclusive look inside a Chinese iPhone manufacturing plant where Apple claimed it has addressed cases of excessive...
first lookassembly plantinsidepegatron
https://www.cbsnews.com/video/fbi-investigating-deaths-disappearances-staff-secretive-government-laboratories/
FBI investigating deaths, disappearances of staff at secretive government laboratories - CBS News
The FBI is investigating possible connections in the cases of 10 missing or dead scientists and staff who worked at sensitive nuclear or space technology...
https://appleinsider.com/articles/25/03/13/us-lawmakers-denounce-uks-secretive-attack-against-apple-encryption
US lawmakers denounces UK's secretive Apple security hearing
A bipartisan group of U.S. lawmakers are coming to Apple's defense over the UK government's attempts to get backdoor access to users' iCloud data, demanding...
apple securityuslawmakersdenouncesuk
https://secretive.dev/
Secretive
Protect your SSH Keys using your Mac's Secure Enclave.
secretive
https://www.cbsnews.com/video/investigation-deaths-disappearances-staff-secretive-government-labs/
Investigation into deaths, disappearances of staff at secretive government labs - CBS News
The FBI is investigating the cases of at least 10 staffers at secret government labs who have either died or disappeared. CBS News' Anna Schecter has the...
https://archive-yaleglobal.yale.edu/content/headwinds-us-moves-toward-secretive-trade-agreement
Headwinds as the US Moves Toward Secretive Trade Agreement | YaleGlobal Online
the ustrade agreementheadwindsmoves
https://preprod.bigthink.com/videos/john-mccain-is-the-american-govenment-too-secretive/
John McCain: Is the American govenment too secretive? - Big Think
Sep 30, 2021 - McCain says we have to track down the people who want to destroy America.
john mccainthe americangovenmentsecretivebig
https://www.foxbusiness.com/video/6344486621112
Lloyd Austin's secretive hospitalization is 'constitutionally serious': KT McFarland | Fox Business...
lloyd austin
https://www.androidauthority.com/magic-leap-new-video-595617/
Secretive startup Magic Leap demos its augmented reality concept in new video
Mar 20, 2015 - Magic Leap, the secretive augmented reality company, has just sent out a teaser video hinting at what it's been working on since Google's $542 million...
magic leap
https://economictimes.indiatimes.com/news/defence/spacex-launches-secretive-us-military-spacecraft/articleshow/123446414.cms
SpaceX launches secretive US military spacecraft - The Economic Times
A SpaceX Falcon 9 rocket successfully launched the US military's X-37B drone from NASA's Kennedy Space Center on Thursday night. The US Space Force stated that...
spacex launchesus militarysecretivespacecrafteconomic
https://www.latimes.com/archives/la-xpm-1993-08-08-mn-21747-story.html
Utah Polygamists Run Secretive, Multimillion-Dollar Conglomerate : Religion: Kingston family...
Aug 8, 1993 - In many ways, the Davis County Cooperative Society is like any other $150-million conglomerate: It sells shoes, mines coal, operates pawn shops and runs health...
utahrunsecretivedollarconglomerate
https://crimesolutions.ojp.gov/ratedprograms/new-orientation-reducing-threats-health-secretive-problems-affect-readiness-north
Program Profile: New Orientation for Reducing Threats to Health from Secretive-problems That Affect...
This is a prevention planning and implementation system designed to improve risk and protective factors, and reduce secretive problems, in military...
https://tech.hindustantimes.com/tech/news/spacex-postpones-planned-launch-of-us-militarys-secretive-x-37b-spaceplane-71702381353547.html
SpaceX postpones planned launch of US military's secretive X-37B spaceplane | Tech News (HT Tech)
Dec 12, 2023 - SpaceX postpones planned launch of US military's secretive X-37B spaceplane. Know the reason why.
https://realtabooporn.net/video/discover-something-new-with-taboo-a-secretive-taboo-experience/
Discover something new with taboo, a secretive taboo experience. RealTabooPorn.net
Default site description.
discover something newtaboosecretiveexperience
https://europe.chinadaily.com.cn/china/2014-06/26/content_17618093.htm
A secretive cult that exploits the weak and vulnerable[1]|chinadaily.com.cn
The Quannengshen, or Eastern Lightening, sect was banned in China nearly 20 years ago, but it made national headlines after its followers were arrested for...
https://www.cbsnews.com/news/deaths-disappearances-scientists-staff-government-labs/?ftag=CNM-00-10aab4i
FBI investigating deaths and disappearances of staff at secretive government laboratories. Here's...
The disappearances and deaths of 10 government workers tied to nuclear or space technology have sparked speculation online. President Trump said the cases are...
https://www.breitbart.com/the-media/2014/08/06/secret-left-wing-journalists/
1,000-Member Secretive Progressive Journalist Group Uncovered
Aug 6, 2014 - Media Trackers:WASHINGTON, D.C. - A prominent CNN commentator, the top two political reporters for The Huffington Post, a Reuters reporter, the editor of |
membersecretiveprogressivejournalistgroup
https://www.secretive.sg/
Secretive Properties in Singapore
secretivepropertiessingapore
https://www.commondreams.org/news/2022/11/02/snowden-says-shut-down-dhs-after-report-revealed-secretive-effort-police-online
Snowden Says Shut Down DHS After Report Revealed Secretive Effort to Police Online Speech | Common...
Jul 18, 2024 - The NSA whistleblower said creating the Department of Homeland Security "was always a mistake," but "its plan to become the Speech Police is the final straw."
https://www.cnn10.com/videos/cnn10/2024/03/29/ten-20240401orig.cnn
Inside Taiwan’s secretive microchip factory that powers the world economy | CNN
Mar 30, 2024 - Today on CNN 10, Will Ripley gives us a look inside the Taiwan Semiconductor Manufacturing Company, the world’s largest producer of microchips that power...
the worldinsidesecretivemicrochipfactory
https://bestspankingblogs.blogspot.com/2015/05/secretive-spankers-in-woods.html
Best Spanking Blogs: Secretive Spankers in the Woods
in thebestspankingblogssecretive
https://www.space.com/23818-blue-origin-rocket-engine-test-video.html
Amazon CEO Jeff Bezos' Secretive Blue Origin Test-Fires Rocket Engine | Space
Dec 3, 2013 - The secretive private spaceflight company Blue Origin has successfully test-fired a new engine for its rockets that could one day lift cargo and astronauts...
jeff bezosblue origin
https://www.democracynow.org/2009/6/25/exclusive_animal_rights_activist_jailed_at
EXCLUSIVE: Animal Rights Activist Jailed at Secretive Prison Gives First Account of Life Inside a...
In a Democracy Now! exclusive interview, we speak with Andrew Stepanian, an animal rights activist who was jailed at a secretive prison known as a...
https://www.vice.com/sv/article/joseph-finegan-do-not-disturb-sex-party-photos-manchester/
NSFW Photos of the Secretive Orgies in Manchester's Hotel Rooms
Aug 10, 2024 - Joseph Finegan has spent the past two years documenting the sex parties arranged on Craigslist and held around the northern city.
photos ofin manchesternsfwsecretive
https://anotherangryvoice.blogspot.com/2017/12/the-secretive-tory-party-within-party.html?showComment=1740827759383
The secretive Tory "party within a party" drawing up insane policies and promoting Brextremism
Most people are aware that ever since Theresa May threw away her parliamentary majority in her vanity election, she's been at the beck an...
https://www.space.com/18168-secretive-blue-origin-spaceship-abort-test.html
Jeff Bezos' Secretive Spaceship Project Tests Rocket Escape System | Space
Oct 22, 2012 - Blue Origin launched its suborbital crew capsule on Friday, conducting a key pad escape test that brings the company a big step closer to carrying astronauts...
jeff bezossecretivespaceshipprojecttests
https://www.epw.senate.gov/public/index.cfm/press-releases-republican?ID=4D5F2E7B-0B2F-51D8-00DB-5FFF6E2148EB
Vitter Wants Clear Answers on Secretive Social Cost of Carbon Estimates - Majority News - U.S....
Today, U.S. Sen. David Vitter (R-La.), top Republican on the Environment and Public Works (EPW) Committee, wrote the Environmental Protection Agency about the...
https://www.straitstimes.com/asia/east-asia/secretive-chinese-committee-draws-up-list-to-replace-us-tech
Secretive Chinese committee draws up list to replace US tech | The Straits Times
Nov 17, 2021 - Known as Xinchuang, it allows Beijing to overcome US sanctions in fields such as networking and chips. Read more at straitstimes.com.
https://www.commondreams.org/news/2014/03/21/stingray-increased-and-secretive-cell-phone-surveillance-local-police-raises-alarms
'Stingray': Increased and Secretive Cell Phone Surveillance by Local Police Raises Alarms | Common...
Jul 18, 2024 - ACLU calls technology the "electronic equivalent of dragnet searches" prohibited by the Fourth Amendment
https://bfsi.economictimes.indiatimes.com/news/banking/switzerlands-secretive-credit-suisse-rescue-rocks-global-finance/98866393
Switzerland's secretive Credit Suisse rescue rocks global finance, ETBFSI
Days before a hastily convened press conference late on Sunday that would make the world's front pages, Switzerland's political elite were secretly preparing a...
credit suisseglobal financeswitzerlandsecretiverescue
https://www.macrumors.com/2016/03/07/tim-cook-secret-meeting-donald-trump/
Tim Cook, Tech CEOs and Top Republicans Attend Secretive Meeting About Donald Trump - MacRumors
Tim Cook attended American Enterprise Institute's annual World Forum this past weekend in Georgia alongside Google CEO Larry Page, Tesla CEO Elon Musk, and...
https://www.salon.com/2021/11/04/key-figure-in-secretive-right-wing-christian-group-makes-a-pitch-for-elon-musks-money_partner/
Key figure in secretive right-wing Christian group makes a pitch for Elon Musk's money - Salon.com
Nov 4, 2021 - David Beasley went viral asking Elon Musk to fund UN hunger program. But he didn't mention his own background
https://mongabay.libsyn.com/secretive-regional-fisheries-management-organizations-need-media-coverage
Mongabay Newscast: Secretive regional fisheries management organizations need media coverage
Seventeen (RFMOs) regulate commercially valuable fish species across the world's oceans. The members of these organizations do not publicize their meetings and...
fisheries managementmongabaynewscastsecretiveregional
https://tech.hindustantimes.com/amp/tech/news/spacex-postpones-planned-launch-of-us-militarys-secretive-x-37b-spaceplane-71702381353547.html
SpaceX postpones planned launch of US military's secretive X-37B spaceplane | Tech News (HT Tech)
Dec 12, 2023 - SpaceX postpones planned launch of US military's secretive X-37B spaceplane. Know the reason why.
https://www.twz.com/air/palmdale-ufo-scare-leads-to-revelations-about-mystery-drone-incursions-over-secretive-plant-42
Palmdale UFO Scare Leads To Revelations About Mystery Drone Incursions Over Secretive Plant 42
While it isn't clear if the two are related, our investigation into the sightings has revealed that the home to Skunk Works has experienced a very concerning...
https://www.straitstimes.com/world/europe/russian-tankers-fuelled-north-korea-via-transfers-at-sea-sources
Russian tankers supplied oil to North Korea via secretive transfers at sea | The Straits Times
Dec 30, 2017 - LONDON/MOSCOW (REUTERS) - Russian tankers have supplied fuel to North Korea on at least three occasions in recent months by transferring cargoes at sea,...
https://science.nasa.gov/resource/secretive-rings/
Secretive Rings - NASA Science
Oct 24, 2024 - Saturn's rings cut across their own shadows on the planet and hide a tiny secret.
secretiveringsnasascience
https://www.rferl.org/a/secretive-turkmenistan-beefs-up-coronavirus-measures-amid-reports-of-first-infections/30470538.html
Secretive Turkmenistan Beefs Up Coronavirus Measures Amid Reports Of First Infections
Sources in Turkmenistan claim at least two patients have recently tested positive for the coronavirus. Authorities in the secretive state reject the claim, but...
secretiveturkmenistancoronavirus
https://bunnyzoescrafts.blogspot.com/2011/08/secretive-tilda.html?m=1
Bunny Zoe's Crafts: Secretive Tilda
Good morning everyone Mina here...I wanted to show you this beautiful Secretive Tilda today and remind you that the new The Winner takes i...
bunny zoes craftssecretivetilda
https://dailynewsfromaolf.substack.com/p/a-secretive-annual-meeting-attended/comments
Comments - Secretive Bilderberg Meeting has AI at Top of Agenga with CEOs from ChatGPT, Google,...
Includes complete list of Bilderberg 2023 Attendees
https://cleanupcityofstaugustine.blogspot.com/2021/10/a-secretive-hedge-fund-is-gutting.html
Clean Up City of St. Augustine, Florida: A SECRETIVE HEDGE FUND IS GUTTING NEWSROOMS Inside Alden...
The Financial Times recently found half of the newspapers in America are controllednby financial firms -- vulture capitalists like Alden Cap...
https://theweek.com/speedreads/966049/biden-almost-certainly-full-access-trumps-secretive-calls-putin-other-world-leaders
Biden almost certainly has full access to Trump's secretive calls with Putin, other world leaders |...
Feb 10, 2021 - The latest Speed Read,/speed-reads,,speed-reads, breaking news, comment, reviews and features from the experts at The Week
https://www.space.com/13763-x37b-sercret-air-force-space-plane-record-time.html
Secretive Air Force Space Plane Nears Orbital Record | Space
Nov 29, 2011 - The Air Force's secretive X-37B space plane is about to set a record for the time its spent in space, reaching the maximum orbital lifetime predicted for it...
air forcesecretivespaceplanenears
https://www.livescience.com/space/watch-the-final-delta-iv-heavy-rocket-launch-secret-cargo-into-space-today
Secretive Delta IV Heavy rocket launch postponed indefinitely | Live Science
Mar 29, 2024 - The final liftoff of a United Launch Alliance Delta IV Heavy rocket was postponed indefinitely following a last-minute nitrogen issue.
delta ivrocket launchsecretiveheavypostponed
https://jackpoulson.substack.com/p/exclusive-usaid-encouraged-outgoing/comments
Comments - Exclusive: USAID encouraged outgoing staff to apply for jobs at secretive Gaza-focused...
Document shows AID's Bureau for Humanitarian Assistance encouraged staff to seek employment at the Gaza Humanitarian Foundation, at request of interim director...
https://africa.businessinsider.com/military-and-defense/inside-the-secretive-schools-where-us-special-operators-learn-to-evade-capture-and/hghe98t
Inside the secretive schools where US special operators learn to evade capture and survive behind...
In combat, all troops face a risk of being captured, and the rules regarding their treatment while in captivity are often ignored
https://www.newstatesman.com/culture/2026/04/the-secretive-london-mansion-that-made-bonnie-blue
Inside the secretive London mansion that made Bonnie Blue - New Statesman
Apr 12, 2026 - How no 32 Portland Place became the city's most notorious venue
inside thebonnie bluesecretivelondonmansion
https://www.foxbusiness.com/video/3353687239001
Is this the most secretive White House in history? | Fox Business Video
White House not transparent?
the mostwhite house
https://simple.wiktionary.org/wiki/secretive
secretive - Simple English Wiktionary
simple englishsecretivewiktionary
https://ec2-3-132-168-84.us-east-2.compute.amazonaws.com/content/local-governments/exclusive-secretive-grand-jury-subpoenas-aliquippa-water-authority
Exclusive: Secretive Grand Jury Subpoenas Aliquippa Water Authority - BeaverCountian.com
Jul 13, 2022 - A secretive grand jury in Pittsburgh being overseen by the Pennsylvania Office of Attorney General has issued subpoenas to the Municipal Water Authority of...
grand jury subpoenaswater authorityexclusivesecretivealiquippa
https://www.space.com/23834-photos-x-37b-space-plane-third-mystery-mission.html
Photos: Secretive X-37B Space Plane's 3rd Mission for the US Air Force | Space
Oct 18, 2014 - See photos of the third mission flown by the US Air Force's secret space plane, the X-37B.
https://deepbluehorizon.blogspot.com/2026/04/secretve-rat-55-spotted-in-amarillo.html
Black Horizon: SECRETIVE RAT 55 SPOTTED IN AMARILLO
spotted inblackhorizonsecretiverat
https://www.cbsnews.com/news/bo-xilai-scandal-rocks-secretive-chinese-leadership/
Bo Xilai scandal rocks secretive Chinese leadership - CBS News
Top Chinese official has been kicked out of the country's powerful committee while his wife is arrested for murder
bo xilaiscandalrockssecretivechinese
https://www.engadget.com/2017-06-07-spacex-will-launch-a-secretive-space-drone-for-the-air-force.html
SpaceX will launch a secretive space drone for the Air Force
Jun 7, 2017 - SpaceX fought hard for the right to launch Air Force projects and it has landed a pretty prestigious one. Elon Musk's company will fire the X-37B miniature...
for thespacexlaunchsecretive
https://www.space.com/spinlaunch-breaks-ground-spaceport-america-facility.html
Secretive Startup SpinLaunch Breaks Ground on Satellite-Flinging Test Flight Facility | Space
May 8, 2019 - SpinLaunch, which aims to change the way small satellites get to orbit, is building a $7 million test facility at the New Mexico spaceport.
https://shirley-mybookshelf.blogspot.com/2012/09/coming-soon-but-secretive.html
My Bookshelf: Coming Soon but Secretive.....
I am so excited to read news of another new novel by legal thriller writer John Grisham!!!! The above image was found on GoodReads and ...
my bookshelfcoming soonsecretive
https://www.sophos.com/en-us/blog/homeland-security-sued-over-secretive-use-of-face-recognition
Homeland Security sued over secretive use of face recognition | SOPHOS
As of June 2019, CBP had processed more than 20 million travelers using facial recognition, civil rights group ACLU says.
homeland securityface recognitionsuedsecretiveuse
https://www.cbsnews.com/news/a-look-at-the-secretive-world-of-air-marshals/
A look at the secretive world of air marshals - CBS News
A quickly growing force of air marshals patrol flights every day, and go through rigorous training beforehand
look atworld ofsecretive
https://www.space.com/17735-secretive-x37b-space-plane-october-launch.html
Air Force Launching Secretive X-37B Space Plane in October | Space
Sep 24, 2012 - The U.S. military's hush-hush X-37B space plane is slated to blast off again next month, Air Force officials say.
air forcelaunchingsecretivexspace
https://mt-milcom.blogspot.com/2012/10/air-force-launching-secretive-x-37b.html
Milcom Monitoring Post: Air Force launching secretive X-37B space plane in October
Leonard David is reporting at Space.com that the U.S. military's hush-hush robotic X-37B space plane is slated to blast off again thi...
https://www.engadget.com/2008-06-04-goldstrikers-work-makes-the-lg-secret-decidedly-less-secretive.html
Goldstriker's work makes the LG Secret decidedly less secretive
Jun 4, 2008 - As members of LG's fashion line, neither the KF600 nor KF750 Secret were ever designed to be completely anonymous, per se, and they definitely won't be if you...
lg secretworkmakesdecidedlyless
https://www.jpost.com/health-science/what-is-the-secretive-institute-that-found-an-antibody-to-the-coronavirus-627133
This is the secretive institute that found an antibody to the coronavirus | The Jerusalem Post
Tucked away in an orange grove in Ness Ziona, the history of the Institute for Biological Research goes back before the founding of the State of Israel.
https://appleinsider.com/articles/18/05/29/a-look-at-apples-secretive-strategies-set-to-unfold-at-wwdc-2018
A look at Apple's secretive strategies set to unfold at WWDC 2018 | AppleInsider
Apple's annual Worldwide Developer Conference is often mistaken for a hardware product launch event. However, the main purpose of WWDC is to introduce Apple's...
https://preprod.bigthink.com/videos/mitt-romneyis-the-american-government-too-secretive/
Mitt Romney:Is the American government too secretive? - Big Think
Sep 30, 2021 - Our national security should not be an open secret.
mitt romneythe americangovernmentsecretivebig
https://pmc.ncbi.nlm.nih.gov/articles/PMC10063382/
Secretive derived from hypoxia preconditioned mesenchymal stem cells promote cartilage regeneration...
Secretome derived from mesenchymal stem cells (MSCs) have profound effects on tissue regeneration, which could become the basis of future MSCs therapies....
mesenchymal stem cellssecretivederivedhypoxia
https://www.cbsnews.com/miami/video/spacex-rocket-launches-on-secretive-mission/
SpaceX rocket launches on secretive mission - CBS Miami
The US military's Space Systems Command said only that the launch will put multiple satellites into orbit on behalf of the Space Systems Command's Innovation...
rocket launchesspacexsecretivemissioncbs
https://www.salon.com/2021/01/31/hawley-and-cruz-at-mercy-of-secretive-senate-panel-probing-their-roles-in-capitol-riot-report_partner/
Hawley and Cruz at mercy of "secretive" Senate panel probing their roles in Capitol riot: report -...
Jan 31, 2021 - The committee is being steered by Sen. Chris Coons, who has called for both of his Republican colleagues to resign
https://www.nobelprize.org/npii/videos/scientists-secretive-work/
Should scientists be secretive about their work? - NobelPrize.org
their workscientistssecretivenobelprize
https://www.cato.org/multimedia/media-highlights-tv/julian-sanchezs-comments-article-ice-just-launched-24m-contract
Julian Sanchez's comments from the article, "Ice Just Launched a $2.4m Contract with a Secretive...
https://guntherportfolio.blogspot.com/2006/08/secretive-solar-start-up-solarvalue-ag.html
GUNTHER Portfolio: Secretive solar start-up, Solarvalue AG, reveals solar grade silicon production...
solar start
https://warnewsupdates.blogspot.com/2009/12/cia-caught-in-dirty-and-secretive-war.html?showComment=1763308877604
War News Updates: CIA Caught In Dirty And Secretive War Against Al-Qaeda On Afghan Border
A blog that covers wars, conflicts, politics, and international news.
https://www.thenationalnews.com/mena/israel-s-secretive-nuclear-facility-gets-a-revamp-1.1172967
Israel's secretive nuclear facility gets a revamp | The National
Jul 2, 2021 - Undeclared atomic weapons programme undergoes biggest construction project in decades
nuclear facilityisraelsecretivegetsrevamp
https://www.edweek.org/leadership/paper-sues-cincinnati-schools-over-secretive-search/2002/11
Paper Sues Cincinnati Schools Over Secretive Search
papersuescincinnatischoolssecretive
https://www.space.com/8998-secretive-37b-space-plane-orbit-phone-app.html
See the Secretive X-37B Space Plane in Orbit with Phone App | Space
Aug 23, 2010 - Seasoned skywatchers can get some help spotting the mysterious U.S. Air Force space plane with a new phone app.
see the
https://europe.chinadaily.com.cn/china/2014-06/26/content_17618093_5.htm
A secretive cult that exploits the weak and vulnerable[5]|chinadaily.com.cn
The Quannengshen, or Eastern Lightening, sect was banned in China nearly 20 years ago, but it made national headlines after its followers were arrested for...
https://boris-portal.unibe.ch/entities/publication/aa1499d9-173b-446b-ae1a-9fe47aa83cc6
The Basel Committee of Banking Supervision - A secretive Club of Giants?
banking supervisionbaselcommitteesecretiveclub
https://www.macrumors.com/2015/09/01/apple-automotive-team-new-hires/
Apple Continues to Recruit Talent to Join Secretive Automotive Team - MacRumors
Apple continues to recruit talent to bolster its "Project Titan" team, which is rumored to be researching an electric vehicle. Over the past several weeks, the...
recruit talentapplecontinuesjoinsecretive
https://appleinsider.com/articles/11/12/22/1976_letter_calls_21_year_old_steve_jobs_a_hard_bargaining_secretive_joker
1976 letter calls 21-year-old Steve Jobs a hard bargaining, secretive 'joker' | AppleInsider
Before he became one of the most recognizable people in the world, a 21-year-old Steve Jobs was met with skepticism in Silicon Valley when he was starting...
https://www.livescience.com/5103-fringe-science-secretive-project-stargate.html
Fringe Science and the Secretive Project Stargate | Live Science
Sep 18, 2008 - One of the most anticipated television shows of the fall season is Fringe.
fringe scienceand theproject stargatesecretivelive
https://appleinsider.com/articles/14/08/11/apples-highly-secretive-apple-university-profiled-in-nyt-feature
Apple's highly secretive Apple University profiled in NYT feature | AppleInsider
The brainchild of Apple cofounder Steve Jobs, Apple University is widely discussed, but little is known about the internal program meant to foster company...
applehighlysecretiveuniversityprofiled
https://cvesdreporter.blogspot.com/2012/07/new-cve-president-jennefer-porch-is-as.html
CVESD Reporter: New CVE president Jennefer Porch is as secretive as Peg Myers
The annual CTA Presidents' Conference is taking place at Asilomar State Beach (see photo) near Monterey. New Chula Vista Educators presid...
https://thesilicongraybeard.blogspot.com/2025/07/the-secretive-x-37b-space-plane-to.html?m=1
The Silicon Graybeard: The secretive X-37B space plane to launch NET August 21
Ordinarily launches of the X-37B space plane and its various missions stay wrapped in the secrecy veil of the mission and don't get muc...
the silicon graybeard
https://jammiewearingfool.blogspot.com/2011/04/transparency-secretive-obama-wont.html
JammieWearingFool: Transparency: Secretive Obama Won't Reveal Fundraising Numbers
They must be raking it in from overseas again. Pres. Obama's re-election campaign won't be disclosing how much money is taken in at the ind...
transparencysecretiveobamarevealfundraising
https://www.eff.org/press/releases/eff-demands-information-about-secretive-government-tattoo-recognition-technology?language=en
EFF Demands Information About Secretive Government Tattoo Recognition Technology | Electronic...
Nov 30, 2017 - Washington, D.C. - The Electronic Frontier Foundation (EFF) filed suit against the Department of Justice, the Department of Commerce, and the Department of...
information abouteffdemandssecretivegovernment
https://www.ibtimes.co.uk/3-luton-men-who-praised-charlie-hebdo-attack-found-guilty-encouraging-children-join-isis-1576425
Luton men guilty of encouraging children to join Isis at secretive meetings | IBTimes UK
Aug 17, 2016 - The men collected funds to pay the legal fees of convicted terrorist Omar Bakri Muhammed.