Robuta

https://www.wired.com/story/leak-exposes-members-of-peter-thiels-secretive-dialog-society/ Leak Exposes Members of Peter Thiel’s Secretive ‘Dialog’ Society | WIRED Jun 16, 2026 - More than 200 of the world's elites registered for a retreat whose agenda runs from panels on cult-building and sex to prepping for World War III. An... members ofleakexposespetersecretive https://www.cbsnews.com/news/deaths-disappearances-scientists-staff-government-labs/ FBI investigating deaths and disappearances of staff at secretive government laboratories. Here's... The disappearances and deaths of 10 government workers tied to nuclear or space technology have sparked speculation online. President Trump said the cases are... https://www.eff.org/deeplinks/2020/06/inside-invasive-secretive-bossware-tracking-workers Inside the Invasive, Secretive “Bossware” Tracking Workers | Electronic Frontier Foundation COVID-19 has pushed millions of people to work from home, and a flock of companies offering software for tracking workers has swooped in to pitch their... inside theinvasivesecretivetrackingworkers https://netzpolitik.org/2019/facebook-and-airbus-hold-secretive-drone-tests-in-the-australian-bush/ Facebook and Airbus hold secretive drone tests in the Australian bush - netzpolitik.org Jan 21, 2019 - The social network company killed its own Aquila drone programme last year. But Facebook has not quit plans to spread internet across the globe. We publish a... https://thechroniclesoforange.blogspot.com/2010/02/primas-being-all-secretive-and-stuff.html The Chronicles of Orange: PRIMA's being all secretive and stuff! apparently Prima has some BIG news! they can't quite share it YET, so we'll have to watch for their big announcement! Prima says... "we ha... the chroniclesorangeprima https://www.newswire.ca/news-releases/canadas-most-secretive-local-government-agency-toronto-hydro-652808093.html Canada's most secretive local government agency: Toronto Hydro /CNW/ - Toronto Hydro is the 2017 recipient of the Code of Silence Award for Outstanding Achievement in Government Secrecy in the category of local... local governmentcanadasecretiveagencytoronto https://isthebbcbiased.blogspot.com/2014/07/the-secretive-bbc.html Is the BBC biased?: The secretive BBC For those of us who have watched the BBC's relentless use of legal loopholes to weasel their way out of releasing the Balen Report, thi... the bbcbiasedsecretive https://dec.ny.gov/nature/animals-fish-plants/biodiversity-species-conservation/secretive-marsh-birds Secretive Marsh Birds - NYSDEC marsh birdssecretivenysdec https://www.macrumors.com/2016/04/25/inside-pegatron-secretive-iphone-assembly-plant/ First Look Inside Pegatron's Secretive Shanghai iPhone Assembly Plant - MacRumors Bloomberg has been granted an exclusive look inside a Chinese iPhone manufacturing plant where Apple claimed it has addressed cases of excessive... first lookassembly plantinsidepegatron https://www.cbsnews.com/video/fbi-investigating-deaths-disappearances-staff-secretive-government-laboratories/ FBI investigating deaths, disappearances of staff at secretive government laboratories - CBS News The FBI is investigating possible connections in the cases of 10 missing or dead scientists and staff who worked at sensitive nuclear or space technology... https://appleinsider.com/articles/25/03/13/us-lawmakers-denounce-uks-secretive-attack-against-apple-encryption US lawmakers denounces UK's secretive Apple security hearing A bipartisan group of U.S. lawmakers are coming to Apple's defense over the UK government's attempts to get backdoor access to users' iCloud data, demanding... apple securityuslawmakersdenouncesuk https://secretive.dev/ Secretive Protect your SSH Keys using your Mac's Secure Enclave. secretive https://www.cbsnews.com/video/investigation-deaths-disappearances-staff-secretive-government-labs/ Investigation into deaths, disappearances of staff at secretive government labs - CBS News The FBI is investigating the cases of at least 10 staffers at secret government labs who have either died or disappeared. CBS News' Anna Schecter has the... https://archive-yaleglobal.yale.edu/content/headwinds-us-moves-toward-secretive-trade-agreement Headwinds as the US Moves Toward Secretive Trade Agreement | YaleGlobal Online the ustrade agreementheadwindsmoves https://preprod.bigthink.com/videos/john-mccain-is-the-american-govenment-too-secretive/ John McCain: Is the American govenment too secretive? - Big Think Sep 30, 2021 - McCain says we have to track down the people who want to destroy America. john mccainthe americangovenmentsecretivebig https://www.foxbusiness.com/video/6344486621112 Lloyd Austin's secretive hospitalization is 'constitutionally serious': KT McFarland | Fox Business... lloyd austin https://www.androidauthority.com/magic-leap-new-video-595617/ Secretive startup Magic Leap demos its augmented reality concept in new video Mar 20, 2015 - Magic Leap, the secretive augmented reality company, has just sent out a teaser video hinting at what it's been working on since Google's $542 million... magic leap https://economictimes.indiatimes.com/news/defence/spacex-launches-secretive-us-military-spacecraft/articleshow/123446414.cms SpaceX launches secretive US military spacecraft - The Economic Times A SpaceX Falcon 9 rocket successfully launched the US military's X-37B drone from NASA's Kennedy Space Center on Thursday night. The US Space Force stated that... spacex launchesus militarysecretivespacecrafteconomic https://www.latimes.com/archives/la-xpm-1993-08-08-mn-21747-story.html Utah Polygamists Run Secretive, Multimillion-Dollar Conglomerate : Religion: Kingston family... Aug 8, 1993 - In many ways, the Davis County Cooperative Society is like any other $150-million conglomerate: It sells shoes, mines coal, operates pawn shops and runs health... utahrunsecretivedollarconglomerate https://crimesolutions.ojp.gov/ratedprograms/new-orientation-reducing-threats-health-secretive-problems-affect-readiness-north Program Profile: New Orientation for Reducing Threats to Health from Secretive-problems That Affect... This is a prevention planning and implementation system designed to improve risk and protective factors, and reduce secretive problems, in military... https://tech.hindustantimes.com/tech/news/spacex-postpones-planned-launch-of-us-militarys-secretive-x-37b-spaceplane-71702381353547.html SpaceX postpones planned launch of US military's secretive X-37B spaceplane | Tech News (HT Tech) Dec 12, 2023 - SpaceX postpones planned launch of US military's secretive X-37B spaceplane. Know the reason why. https://realtabooporn.net/video/discover-something-new-with-taboo-a-secretive-taboo-experience/ Discover something new with taboo, a secretive taboo experience. RealTabooPorn.net Default site description. discover something newtaboosecretiveexperience https://europe.chinadaily.com.cn/china/2014-06/26/content_17618093.htm A secretive cult that exploits the weak and vulnerable[1]|chinadaily.com.cn The Quannengshen, or Eastern Lightening, sect was banned in China nearly 20 years ago, but it made national headlines after its followers were arrested for... https://www.cbsnews.com/news/deaths-disappearances-scientists-staff-government-labs/?ftag=CNM-00-10aab4i FBI investigating deaths and disappearances of staff at secretive government laboratories. Here's... The disappearances and deaths of 10 government workers tied to nuclear or space technology have sparked speculation online. President Trump said the cases are... https://www.breitbart.com/the-media/2014/08/06/secret-left-wing-journalists/ 1,000-Member Secretive Progressive Journalist Group Uncovered Aug 6, 2014 - Media Trackers:WASHINGTON, D.C. - A prominent CNN commentator, the top two political reporters for The Huffington Post, a Reuters reporter, the editor of | membersecretiveprogressivejournalistgroup https://www.secretive.sg/ Secretive Properties in Singapore secretivepropertiessingapore https://www.commondreams.org/news/2022/11/02/snowden-says-shut-down-dhs-after-report-revealed-secretive-effort-police-online Snowden Says Shut Down DHS After Report Revealed Secretive Effort to Police Online Speech | Common... Jul 18, 2024 - The NSA whistleblower said creating the Department of Homeland Security "was always a mistake," but "its plan to become the Speech Police is the final straw." https://www.cnn10.com/videos/cnn10/2024/03/29/ten-20240401orig.cnn Inside Taiwan’s secretive microchip factory that powers the world economy | CNN Mar 30, 2024 - Today on CNN 10, Will Ripley gives us a look inside the Taiwan Semiconductor Manufacturing Company, the world’s largest producer of microchips that power... the worldinsidesecretivemicrochipfactory https://bestspankingblogs.blogspot.com/2015/05/secretive-spankers-in-woods.html Best Spanking Blogs: Secretive Spankers in the Woods in thebestspankingblogssecretive https://www.space.com/23818-blue-origin-rocket-engine-test-video.html Amazon CEO Jeff Bezos' Secretive Blue Origin Test-Fires Rocket Engine | Space Dec 3, 2013 - The secretive private spaceflight company Blue Origin has successfully test-fired a new engine for its rockets that could one day lift cargo and astronauts... jeff bezosblue origin https://www.democracynow.org/2009/6/25/exclusive_animal_rights_activist_jailed_at EXCLUSIVE: Animal Rights Activist Jailed at Secretive Prison Gives First Account of Life Inside a... In a Democracy Now! exclusive interview, we speak with Andrew Stepanian, an animal rights activist who was jailed at a secretive prison known as a... https://www.vice.com/sv/article/joseph-finegan-do-not-disturb-sex-party-photos-manchester/ NSFW Photos of the Secretive Orgies in Manchester's Hotel Rooms Aug 10, 2024 - Joseph Finegan has spent the past two years documenting the sex parties arranged on Craigslist and held around the northern city. photos ofin manchesternsfwsecretive https://anotherangryvoice.blogspot.com/2017/12/the-secretive-tory-party-within-party.html?showComment=1740827759383 The secretive Tory "party within a party" drawing up insane policies and promoting Brextremism Most people are aware that ever since Theresa May threw away her parliamentary majority in her vanity election, she's been at the beck an... https://www.space.com/18168-secretive-blue-origin-spaceship-abort-test.html Jeff Bezos' Secretive Spaceship Project Tests Rocket Escape System | Space Oct 22, 2012 - Blue Origin launched its suborbital crew capsule on Friday, conducting a key pad escape test that brings the company a big step closer to carrying astronauts... jeff bezossecretivespaceshipprojecttests https://www.epw.senate.gov/public/index.cfm/press-releases-republican?ID=4D5F2E7B-0B2F-51D8-00DB-5FFF6E2148EB Vitter Wants Clear Answers on Secretive Social Cost of Carbon Estimates - Majority News - U.S.... Today, U.S. Sen. David Vitter (R-La.), top Republican on the Environment and Public Works (EPW) Committee, wrote the Environmental Protection Agency about the... https://www.straitstimes.com/asia/east-asia/secretive-chinese-committee-draws-up-list-to-replace-us-tech Secretive Chinese committee draws up list to replace US tech | The Straits Times Nov 17, 2021 - Known as Xinchuang, it allows Beijing to overcome US sanctions in fields such as networking and chips. Read more at straitstimes.com. https://www.commondreams.org/news/2014/03/21/stingray-increased-and-secretive-cell-phone-surveillance-local-police-raises-alarms 'Stingray': Increased and Secretive Cell Phone Surveillance by Local Police Raises Alarms | Common... Jul 18, 2024 - ACLU calls technology the "electronic equivalent of dragnet searches" prohibited by the Fourth Amendment https://bfsi.economictimes.indiatimes.com/news/banking/switzerlands-secretive-credit-suisse-rescue-rocks-global-finance/98866393 Switzerland's secretive Credit Suisse rescue rocks global finance, ETBFSI Days before a hastily convened press conference late on Sunday that would make the world's front pages, Switzerland's political elite were secretly preparing a... credit suisseglobal financeswitzerlandsecretiverescue https://www.macrumors.com/2016/03/07/tim-cook-secret-meeting-donald-trump/ Tim Cook, Tech CEOs and Top Republicans Attend Secretive Meeting About Donald Trump - MacRumors Tim Cook attended American Enterprise Institute's annual World Forum this past weekend in Georgia alongside Google CEO Larry Page, Tesla CEO Elon Musk, and... https://www.salon.com/2021/11/04/key-figure-in-secretive-right-wing-christian-group-makes-a-pitch-for-elon-musks-money_partner/ Key figure in secretive right-wing Christian group makes a pitch for Elon Musk's money - Salon.com Nov 4, 2021 - David Beasley went viral asking Elon Musk to fund UN hunger program. But he didn't mention his own background https://mongabay.libsyn.com/secretive-regional-fisheries-management-organizations-need-media-coverage Mongabay Newscast: Secretive regional fisheries management organizations need media coverage Seventeen (RFMOs) regulate commercially valuable fish species across the world's oceans. The members of these organizations do not publicize their meetings and... fisheries managementmongabaynewscastsecretiveregional https://tech.hindustantimes.com/amp/tech/news/spacex-postpones-planned-launch-of-us-militarys-secretive-x-37b-spaceplane-71702381353547.html SpaceX postpones planned launch of US military's secretive X-37B spaceplane | Tech News (HT Tech) Dec 12, 2023 - SpaceX postpones planned launch of US military's secretive X-37B spaceplane. Know the reason why. https://www.twz.com/air/palmdale-ufo-scare-leads-to-revelations-about-mystery-drone-incursions-over-secretive-plant-42 Palmdale UFO Scare Leads To Revelations About Mystery Drone Incursions Over Secretive Plant 42 While it isn't clear if the two are related, our investigation into the sightings has revealed that the home to Skunk Works has experienced a very concerning... https://www.straitstimes.com/world/europe/russian-tankers-fuelled-north-korea-via-transfers-at-sea-sources Russian tankers supplied oil to North Korea via secretive transfers at sea | The Straits Times Dec 30, 2017 - LONDON/MOSCOW (REUTERS) - Russian tankers have supplied fuel to North Korea on at least three occasions in recent months by transferring cargoes at sea,... https://science.nasa.gov/resource/secretive-rings/ Secretive Rings - NASA Science Oct 24, 2024 - Saturn's rings cut across their own shadows on the planet and hide a tiny secret. secretiveringsnasascience https://www.rferl.org/a/secretive-turkmenistan-beefs-up-coronavirus-measures-amid-reports-of-first-infections/30470538.html Secretive Turkmenistan Beefs Up Coronavirus Measures Amid Reports Of First Infections Sources in Turkmenistan claim at least two patients have recently tested positive for the coronavirus. Authorities in the secretive state reject the claim, but... secretiveturkmenistancoronavirus https://bunnyzoescrafts.blogspot.com/2011/08/secretive-tilda.html?m=1 Bunny Zoe's Crafts: Secretive Tilda Good morning everyone Mina here...I wanted to show you this beautiful Secretive Tilda today and remind you that the new The Winner takes i... bunny zoes craftssecretivetilda https://dailynewsfromaolf.substack.com/p/a-secretive-annual-meeting-attended/comments Comments - Secretive Bilderberg Meeting has AI at Top of Agenga with CEOs from ChatGPT, Google,... Includes complete list of Bilderberg 2023 Attendees https://cleanupcityofstaugustine.blogspot.com/2021/10/a-secretive-hedge-fund-is-gutting.html Clean Up City of St. Augustine, Florida: A SECRETIVE HEDGE FUND IS GUTTING NEWSROOMS Inside Alden... The Financial Times recently found half of the newspapers in America are controllednby financial firms -- vulture capitalists like Alden Cap... https://theweek.com/speedreads/966049/biden-almost-certainly-full-access-trumps-secretive-calls-putin-other-world-leaders Biden almost certainly has full access to Trump's secretive calls with Putin, other world leaders |... Feb 10, 2021 - The latest Speed Read,/speed-reads,,speed-reads, breaking news, comment, reviews and features from the experts at The Week https://www.space.com/13763-x37b-sercret-air-force-space-plane-record-time.html Secretive Air Force Space Plane Nears Orbital Record | Space Nov 29, 2011 - The Air Force's secretive X-37B space plane is about to set a record for the time its spent in space, reaching the maximum orbital lifetime predicted for it... air forcesecretivespaceplanenears https://www.livescience.com/space/watch-the-final-delta-iv-heavy-rocket-launch-secret-cargo-into-space-today Secretive Delta IV Heavy rocket launch postponed indefinitely | Live Science Mar 29, 2024 - The final liftoff of a United Launch Alliance Delta IV Heavy rocket was postponed indefinitely following a last-minute nitrogen issue. delta ivrocket launchsecretiveheavypostponed https://jackpoulson.substack.com/p/exclusive-usaid-encouraged-outgoing/comments Comments - Exclusive: USAID encouraged outgoing staff to apply for jobs at secretive Gaza-focused... Document shows AID's Bureau for Humanitarian Assistance encouraged staff to seek employment at the Gaza Humanitarian Foundation, at request of interim director... https://africa.businessinsider.com/military-and-defense/inside-the-secretive-schools-where-us-special-operators-learn-to-evade-capture-and/hghe98t Inside the secretive schools where US special operators learn to evade capture and survive behind... In combat, all troops face a risk of being captured, and the rules regarding their treatment while in captivity are often ignored https://www.newstatesman.com/culture/2026/04/the-secretive-london-mansion-that-made-bonnie-blue Inside the secretive London mansion that made Bonnie Blue - New Statesman Apr 12, 2026 - How no 32 Portland Place became the city's most notorious venue inside thebonnie bluesecretivelondonmansion https://www.foxbusiness.com/video/3353687239001 Is this the most secretive White House in history? | Fox Business Video White House not transparent? the mostwhite house https://simple.wiktionary.org/wiki/secretive secretive - Simple English Wiktionary simple englishsecretivewiktionary https://ec2-3-132-168-84.us-east-2.compute.amazonaws.com/content/local-governments/exclusive-secretive-grand-jury-subpoenas-aliquippa-water-authority Exclusive: Secretive Grand Jury Subpoenas Aliquippa Water Authority - BeaverCountian.com Jul 13, 2022 - A secretive grand jury in Pittsburgh being overseen by the Pennsylvania Office of Attorney General has issued subpoenas to the Municipal Water Authority of... grand jury subpoenaswater authorityexclusivesecretivealiquippa https://www.space.com/23834-photos-x-37b-space-plane-third-mystery-mission.html Photos: Secretive X-37B Space Plane's 3rd Mission for the US Air Force | Space Oct 18, 2014 - See photos of the third mission flown by the US Air Force's secret space plane, the X-37B. https://deepbluehorizon.blogspot.com/2026/04/secretve-rat-55-spotted-in-amarillo.html Black Horizon: SECRETIVE RAT 55 SPOTTED IN AMARILLO spotted inblackhorizonsecretiverat https://www.cbsnews.com/news/bo-xilai-scandal-rocks-secretive-chinese-leadership/ Bo Xilai scandal rocks secretive Chinese leadership - CBS News Top Chinese official has been kicked out of the country's powerful committee while his wife is arrested for murder bo xilaiscandalrockssecretivechinese https://www.engadget.com/2017-06-07-spacex-will-launch-a-secretive-space-drone-for-the-air-force.html SpaceX will launch a secretive space drone for the Air Force Jun 7, 2017 - SpaceX fought hard for the right to launch Air Force projects and it has landed a pretty prestigious one. Elon Musk's company will fire the X-37B miniature... for thespacexlaunchsecretive https://www.space.com/spinlaunch-breaks-ground-spaceport-america-facility.html Secretive Startup SpinLaunch Breaks Ground on Satellite-Flinging Test Flight Facility | Space May 8, 2019 - SpinLaunch, which aims to change the way small satellites get to orbit, is building a $7 million test facility at the New Mexico spaceport. https://shirley-mybookshelf.blogspot.com/2012/09/coming-soon-but-secretive.html My Bookshelf: Coming Soon but Secretive..... I am so excited to read news of another new novel by legal thriller writer John Grisham!!!! The above image was found on GoodReads and ... my bookshelfcoming soonsecretive https://www.sophos.com/en-us/blog/homeland-security-sued-over-secretive-use-of-face-recognition Homeland Security sued over secretive use of face recognition | SOPHOS As of June 2019, CBP had processed more than 20 million travelers using facial recognition, civil rights group ACLU says. homeland securityface recognitionsuedsecretiveuse https://www.cbsnews.com/news/a-look-at-the-secretive-world-of-air-marshals/ A look at the secretive world of air marshals - CBS News A quickly growing force of air marshals patrol flights every day, and go through rigorous training beforehand look atworld ofsecretive https://www.space.com/17735-secretive-x37b-space-plane-october-launch.html Air Force Launching Secretive X-37B Space Plane in October | Space Sep 24, 2012 - The U.S. military's hush-hush X-37B space plane is slated to blast off again next month, Air Force officials say. air forcelaunchingsecretivexspace https://mt-milcom.blogspot.com/2012/10/air-force-launching-secretive-x-37b.html Milcom Monitoring Post: Air Force launching secretive X-37B space plane in October Leonard David is reporting at Space.com that the U.S. military's hush-hush robotic X-37B space plane is slated to blast off again thi... https://www.engadget.com/2008-06-04-goldstrikers-work-makes-the-lg-secret-decidedly-less-secretive.html Goldstriker's work makes the LG Secret decidedly less secretive Jun 4, 2008 - As members of LG's fashion line, neither the KF600 nor KF750 Secret were ever designed to be completely anonymous, per se, and they definitely won't be if you... lg secretworkmakesdecidedlyless https://www.jpost.com/health-science/what-is-the-secretive-institute-that-found-an-antibody-to-the-coronavirus-627133 This is the secretive institute that found an antibody to the coronavirus | The Jerusalem Post Tucked away in an orange grove in Ness Ziona, the history of the Institute for Biological Research goes back before the founding of the State of Israel. https://appleinsider.com/articles/18/05/29/a-look-at-apples-secretive-strategies-set-to-unfold-at-wwdc-2018 A look at Apple's secretive strategies set to unfold at WWDC 2018 | AppleInsider Apple's annual Worldwide Developer Conference is often mistaken for a hardware product launch event. However, the main purpose of WWDC is to introduce Apple's... https://preprod.bigthink.com/videos/mitt-romneyis-the-american-government-too-secretive/ Mitt Romney:Is the American government too secretive? - Big Think Sep 30, 2021 - Our national security should not be an open secret. mitt romneythe americangovernmentsecretivebig https://pmc.ncbi.nlm.nih.gov/articles/PMC10063382/ Secretive derived from hypoxia preconditioned mesenchymal stem cells promote cartilage regeneration... Secretome derived from mesenchymal stem cells (MSCs) have profound effects on tissue regeneration, which could become the basis of future MSCs therapies.... mesenchymal stem cellssecretivederivedhypoxia https://www.cbsnews.com/miami/video/spacex-rocket-launches-on-secretive-mission/ SpaceX rocket launches on secretive mission - CBS Miami The US military's Space Systems Command said only that the launch will put multiple satellites into orbit on behalf of the Space Systems Command's Innovation... rocket launchesspacexsecretivemissioncbs https://www.salon.com/2021/01/31/hawley-and-cruz-at-mercy-of-secretive-senate-panel-probing-their-roles-in-capitol-riot-report_partner/ Hawley and Cruz at mercy of "secretive" Senate panel probing their roles in Capitol riot: report -... Jan 31, 2021 - The committee is being steered by Sen. Chris Coons, who has called for both of his Republican colleagues to resign https://www.nobelprize.org/npii/videos/scientists-secretive-work/ Should scientists be secretive about their work? - NobelPrize.org their workscientistssecretivenobelprize https://www.cato.org/multimedia/media-highlights-tv/julian-sanchezs-comments-article-ice-just-launched-24m-contract Julian Sanchez's comments from the article, "Ice Just Launched a $2.4m Contract with a Secretive... https://guntherportfolio.blogspot.com/2006/08/secretive-solar-start-up-solarvalue-ag.html GUNTHER Portfolio: Secretive solar start-up, Solarvalue AG, reveals solar grade silicon production... solar start https://warnewsupdates.blogspot.com/2009/12/cia-caught-in-dirty-and-secretive-war.html?showComment=1763308877604 War News Updates: CIA Caught In Dirty And Secretive War Against Al-Qaeda On Afghan Border A blog that covers wars, conflicts, politics, and international news. https://www.thenationalnews.com/mena/israel-s-secretive-nuclear-facility-gets-a-revamp-1.1172967 Israel's secretive nuclear facility gets a revamp | The National Jul 2, 2021 - Undeclared atomic weapons programme undergoes biggest construction project in decades nuclear facilityisraelsecretivegetsrevamp https://www.edweek.org/leadership/paper-sues-cincinnati-schools-over-secretive-search/2002/11 Paper Sues Cincinnati Schools Over Secretive Search papersuescincinnatischoolssecretive https://www.space.com/8998-secretive-37b-space-plane-orbit-phone-app.html See the Secretive X-37B Space Plane in Orbit with Phone App | Space Aug 23, 2010 - Seasoned skywatchers can get some help spotting the mysterious U.S. Air Force space plane with a new phone app. see the https://europe.chinadaily.com.cn/china/2014-06/26/content_17618093_5.htm A secretive cult that exploits the weak and vulnerable[5]|chinadaily.com.cn The Quannengshen, or Eastern Lightening, sect was banned in China nearly 20 years ago, but it made national headlines after its followers were arrested for... https://boris-portal.unibe.ch/entities/publication/aa1499d9-173b-446b-ae1a-9fe47aa83cc6 The Basel Committee of Banking Supervision - A secretive Club of Giants? banking supervisionbaselcommitteesecretiveclub https://www.macrumors.com/2015/09/01/apple-automotive-team-new-hires/ Apple Continues to Recruit Talent to Join Secretive Automotive Team - MacRumors Apple continues to recruit talent to bolster its "Project Titan" team, which is rumored to be researching an electric vehicle. Over the past several weeks, the... recruit talentapplecontinuesjoinsecretive https://appleinsider.com/articles/11/12/22/1976_letter_calls_21_year_old_steve_jobs_a_hard_bargaining_secretive_joker 1976 letter calls 21-year-old Steve Jobs a hard bargaining, secretive 'joker' | AppleInsider Before he became one of the most recognizable people in the world, a 21-year-old Steve Jobs was met with skepticism in Silicon Valley when he was starting... https://www.livescience.com/5103-fringe-science-secretive-project-stargate.html Fringe Science and the Secretive Project Stargate | Live Science Sep 18, 2008 - One of the most anticipated television shows of the fall season is Fringe. fringe scienceand theproject stargatesecretivelive https://appleinsider.com/articles/14/08/11/apples-highly-secretive-apple-university-profiled-in-nyt-feature Apple's highly secretive Apple University profiled in NYT feature | AppleInsider The brainchild of Apple cofounder Steve Jobs, Apple University is widely discussed, but little is known about the internal program meant to foster company... applehighlysecretiveuniversityprofiled https://cvesdreporter.blogspot.com/2012/07/new-cve-president-jennefer-porch-is-as.html CVESD Reporter: New CVE president Jennefer Porch is as secretive as Peg Myers The annual CTA Presidents' Conference is taking place at Asilomar State Beach (see photo) near Monterey. New Chula Vista Educators presid... https://thesilicongraybeard.blogspot.com/2025/07/the-secretive-x-37b-space-plane-to.html?m=1 The Silicon Graybeard: The secretive X-37B space plane to launch NET August 21 Ordinarily launches of the X-37B space plane and its various missions stay wrapped in the secrecy veil of the mission and don't get muc... the silicon graybeard https://jammiewearingfool.blogspot.com/2011/04/transparency-secretive-obama-wont.html JammieWearingFool: Transparency: Secretive Obama Won't Reveal Fundraising Numbers They must be raking it in from overseas again. Pres. Obama's re-election campaign won't be disclosing how much money is taken in at the ind... transparencysecretiveobamarevealfundraising https://www.eff.org/press/releases/eff-demands-information-about-secretive-government-tattoo-recognition-technology?language=en EFF Demands Information About Secretive Government Tattoo Recognition Technology | Electronic... Nov 30, 2017 - Washington, D.C. - The Electronic Frontier Foundation (EFF) filed suit against the Department of Justice, the Department of Commerce, and the Department of... information abouteffdemandssecretivegovernment https://www.ibtimes.co.uk/3-luton-men-who-praised-charlie-hebdo-attack-found-guilty-encouraging-children-join-isis-1576425 Luton men guilty of encouraging children to join Isis at secretive meetings | IBTimes UK Aug 17, 2016 - The men collected funds to pay the legal fees of convicted terrorist Omar Bakri Muhammed.