https://www.sie.gov.hk/en/what-we-do/research/detail/modular_prosthetics_w_interchanging_task-specific_tools_for_upper_limb_amputeesd41d.html
Modular Prosthetics with Interchanging Task-Specific Tools for Upper Limb Amputees - Research - SIE...
task specificupper limbmodularprostheticstools
https://research-repository.uwa.edu.au/en/projects/the-influence-of-group-size-on-task-specific-intervention-in-chil-2/
The Influence of Group Size on Task Specific Intervention in Children with Coordination...
the influenceon taskgroupsizespecific
https://researchconnect.buffalo.edu/en/publications/convergence-of-meta-learning-with-task-specific-adaptation-over-p/
Convergence of meta-learning with task-specific adaptation over partial parameters - SUNY...
task specificconvergencemetalearningadaptation
https://pure.canterbury.ac.uk/en/publications/task-specific-short-powerpointstm-for-effective-off-campus-learni-2/
Task-specific short PowerPointsTM for effective off-campus learning in diagnostic radiography -...
task specificoff campusshorteffectivelearning
https://www.azolifesciences.com/news/20251017/Task-Specific-Machine-Learning-Architecture-Enhances-Drug-Discovery-Accuracy.aspx
Task-Specific Machine Learning Architecture Enhances Drug Discovery Accuracy
Oct 17, 2025 - The drug development pipeline is a costly and lengthy process. Identifying high-quality "hit" compounds-those with high potency, selectivity, and favorable...
task specificmachine learningdrug discoveryarchitectureaccuracy
https://www.dulyhealthandcare.com/conditions/work-task-specific-training
Work Task Specific Training | Duly Health and Care
health and caretask specificworktraining
https://tldr.chat/technology/effective-evaluation-strategies-for-task-specific-language-models-525a
Effective Evaluation Strategies for Task-Specific Language Models - TL;DR.Chat
Evaluating task-specific language models (LLMs) can be challenging, especially when off-the-shelf evaluation metrics often fail to correlate with performance in
task specificlanguage modelseffectiveevaluationstrategies
https://irf.fhnw.ch/entities/publication/f9f57c07-86da-4916-a52f-ea0263b87d43
Sustainability of general-purpose AI versus task-specific models
Artificial Intelligence (AI) relies on significant energy resources, raising questions about its environmental sustainability, especially as adoption grows in...
general purposeai versustask specificsustainabilitymodels
https://www.amazon.science/code-and-datasets/automated-evaluation-of-retrieval-augmented-language-models-with-task-specific-exam-generation
Automated evaluation of retrieval-augmented language models with task-specific exam generation -...
We propose a new method to measure the task-specific accuracy of Retrieval-Augmented Large Language Models (RAG). Evaluation is performed by scoring the RAG on...
language modelstask specificautomatedevaluationretrieval
https://demo.ever.works/items/40-task-specific-ai-agents-prediction
40% Task-Specific AI Agents Prediction | Ever Works
Gartner predicts that 40% of enterprise applications will leverage task-specific AI agents by 2026, compared to less than 5% in 2025, representing a major sh...
task specificai agentspredictioneverworks
https://www.bringmark.com/faqs/what-percentage-of-enterprise-apps-will-use-task-specific-ai-agents-by-2026
What percentage of enterprise apps will use task-specific AI agents by 2026? | FAQs | Bringmark
Gartner predicts that 40 percent of enterprise apps will use task-specific AI agents by 2026. However, the actual number in production will depend on how...
enterprise appstask specificai agentspercentageuse
https://dataphoenix.info/announcement-of-jurassic-2-and-task-specific-apis/
Announcement of Jurassic-2 and Task-Specific APIs
Mar 17, 2023 - AI21 Studio has announced the launch of the latest generation of base models that have changed the artificial intelligence landscape, providing the highest...
task specificannouncementjurassicapis
https://pubmed.ncbi.nlm.nih.gov/34293643/
Computer Game Assisted Task Specific Exercises in the Treatment of Motor and Cognitive Function and...
CGATSE may be beneficial in providing continuation of care after stroke, especially during the Covid-19 pandemic when home based rehabilitation options are...
computer gametask specificthe treatmentcognitive functionassisted
https://repository.arizona.edu/handle/10150/311799
Short-Term Benefits of Research-Based, Task-Specific Exercises in a Group Setting for People with...
benefits of researchshort termtask specificfor peoplebased
https://openhsu.ub.hsu-hh.de/entities/publication/16698
Transient, sustained, and task-specific non-perceptual conflict adjustment
task specifictransientsustainednonconflict
https://incident-prevention.com/blog/understanding-task-specific-training/
Understanding Task-Specific Training - Incident Prevention
Sep 19, 2023 - If an employer must defend their company in the event of an incident or accident, training records are a critical tool. There is nothing better to present...
task specificunderstandingtrainingincidentprevention
https://knova.um.edu.my/research_publications_2021_2025/7549/
"Pd on a novel nitrogen doped porous carbon derived from task specific " by Masoumeh Dorraj, Samahe...
In attempt to develop low-cost biomass derived carbon materials with improved properties, herein we present a facile method for the fabrication of nitrogen...
on atask specificpdnovelnitrogen
https://dc.ewu.edu/srcw_2026/works_2026/works_2026/4/
EWU Digital Commons - 2026 Symposium: Evaluating Small, Task-Specific LLMs for Reconnaissance in...
Vulnerability identification during penetration testing traditionally relies on rigid string-matching to map network scan data to Common Platform Enumeration...
digital commonstask specificewusymposiumevaluating
https://itcon.org/paper/2015/7
ITcon paper: BIM on the construction site: providing hidden information on task specific drawings...
Journal of Information Technology in Construction
the construction sitetask specificitconpaperbim
https://researchr.org/publication/CaoZCGW23
Task-Specific Feature Purifying in Radar-Based Human Pose Estimation - researchr publication
human pose estimationtask specificfeaturepurifyingradar
https://medlineplus.gov/genetics/condition/task-specific-focal-dystonia/
Task-specific focal dystonia: MedlinePlus Genetics
Task-specific focal dystonia is a movement disorder that interferes with the performance of particular tasks, such as writing, playing a musical instrument, or...
task specificfocaldystoniamedlineplusgenetics
https://papers.neurips.cc/paper_files/paper/2025/hash/12678c3948153f4bc391f51e2082bd6e-Abstract-Conference.html
Energy Landscape-Aware Vision Transformers: Layerwise Dynamics and Adaptive Task-Specific Training...
task specificenergylandscapeawarevision
https://cme.utsouthwestern.edu/129-032019
129 Neurology Grand Rounds: "Athletes with the Yips: Evidence for a Task-Specific Dystonia"...
grand roundstask specificneurologyathletesyips
https://elifesciences.org/articles/13141
Distributed task-specific processing of somatosensory feedback for voluntary motor control | eLife
Somatosensory feedback is transmitted to many sensory and motor cortical regions within 25 milliseconds and ongoing behavioural tasks alter the spatiotemporal...
task specificmotor controldistributedprocessingsomatosensory
https://www.frontiersin.org/journals/neurology/articles/10.3389/fneur.2017.00170/full
Frontiers | Research Priorities in Limb and Task-Specific Dystonias
Dystonia, which causes intermittent or sustained abnormal postures and movements, can present in a focal or a generalized manner. In the limbs, focal dystoni...
research prioritiestask specificfrontierslimbdystonias
https://scholars.hkbu.edu.hk/en/publications/task-specific-balance-training-improves-the-sensory-organisation--2/fingerprints/
Task-Specific Balance Training Improves the Sensory Organisation of Balance Control in Children...
task specificbalance trainingimprovessensoryorganisation
https://ideas.repec.org/a/spr/jlabrs/v46y2013i3d10.1007_s12651-013-0145-y.html
Why to employ both migrants and natives? A study on task-specific substitutability [Warum...
Downloadable! This paper analyses the performance of migrants on the German labour market and its dependence on the tasks performed on their jobs. Recent work...
a studyon taskemploymigrantsnatives
https://openreview.net/forum?id=JDmAymuFFQ
FL-TAC: Enhanced Fine-Tuning in Federated Learning via Low-Rank, Task-Specific Adapter Clustering |...
Although large-scale pre-trained models hold great potential for adapting to downstream tasks through fine-tuning, the performance of such fine-tuned models is...
fine tuningfederated learningtask specificfltac
https://impact.ornl.gov/en/publications/separation-of-fission-products-based-on-ionic-liquids-task-specif/
Separation of fission products based on ionic liquids: Task-specific ionic liquids containing an...
based onionic liquidstask specificseparationfission
https://liner.com/review/jsigan-ganbased-joint-superresolution-and-inverse-tonemapping-with-pixelwise-taskspecific
JSI-GAN: GAN-Based Joint Super-Resolution and Inverse Tone-Mapping with Pixel-Wise Task-Specific...
Regarding this AAAI 2019 paper, this review summarizes JSI-GAN, a novel GAN for joint super-resolution and inverse tone-mapping of UHD HDR video.
super resolutiontask specificjsiganbased
https://pure.eur.nl/en/publications/self-regulated-learning-validating-a-task-specific-questionnaire-/
Self-regulated learning: Validating a task-specific questionnaire for children in elementary school...
a taskfor childrenelementary schoolselfregulated
https://underline.io/lecture/25394-improving-the-faithfulness-of-attention-based-explanations-with-task-specific-information-for-text-classification
Improving the Faithfulness of Attention-based Explanations with Task-specific Information for Text...
On-demand video platform giving you access to lectures from conferences worldwide.
task specificinformation forimprovingfaithfulnessattention
https://pure.seoultech.ac.kr/en/publications/task-specific-preconditioner-for-cross-domain-few-shot-learning/
Task-Specific Preconditioner for Cross-Domain Few-Shot Learning - Seoul National University of...
seoul national universitytask specificcross domainshotlearning
https://www.toolai.io/ai/airops
AirOps - Task-specific AI Apps that take you... - ToolAI.io
task specificai appsairopstakeio
https://cris.haifa.ac.il/en/publications/task-specific-rapid-auditory-perceptual-learning-in-adult-cochlea/
Task-Specific Rapid Auditory Perceptual Learning in Adult Cochlear Implant Recipients: What Could...
task specificcochlear implantrapidauditorylearning
https://scholars.mssm.edu/en/publications/adult-onset-idiopathic-focal-lower-extremity-dystonia-a-rare-task-3/
Adult-onset idiopathic focal lower extremity dystonia: A rare task-specific dystonia - Icahn School...
lower extremitytask specificadultonsetfocal
https://www.eneuro.org/content/7/4/ENEURO.0512-19.2019
Decoding Task-Specific Cognitive States with Slow, Directed Functional Networks in the Human Brain...
Flexible functional interactions among brain regions mediate critical cognitive functions. Such interactions can be measured using functional magnetic...
the human braintask specificdecodingcognitivestates
https://iris.sissa.it/handle/20.500.11767/16972
Nouns and verbs in the brain: Grammatical class and task specific effects as revealed by fMRI
the braintask specificnounsverbsclass
https://research.utwente.nl/en/publications/extracted-species-of-npiv-complex-with-diglycolamide-functionaliz/
Extracted species of Np(IV) complex with diglycolamide functionalized task specific ionic liquid:...
task specificextractedspeciesnpiv
https://ircommons.uwf.edu/esploro/outputs/journalArticle/If-at-First-You-Dont-Succeed/99380576890806600
If at First You Don't Succeed: Effects of Failure on General and Task-Specific Self-Efficacy and...
Mar 1, 2006 - This study explored the impact that failing a specific cognitive task had on self-efficacy and future task performance. Participants were 60 university...
task specificfirstsucceedeffectsfailure
https://pure.ul.ie/en/publications/enhancing-task-specific-distillation-in-small-data-regimes-throug/fingerprints/?sortBy=alphabetically
Enhancing Task-Specific Distillation in Small Data Regimes through Language Generation -...
task specificenhancingdistillationsmalldata
https://www.techscience.com/cmc/v87n3/66960/pdf
CMC | Task-Specific YOLO Optimization for Railway Tunnel Cracks and Water Leakage: Benchmarking and...
The safe operation of railway systems necessitates efficient and automated inspection of tunnel defects. While deep learning offers solutions, a clear pathway...
task specificwater leakagecmcyolooptimization
https://www.zillionpals.com/group/success-stories/discussion/ad3f27fe-cda5-4a5c-bfa5-066a8f4476ff
I went to the market today for a specific task, but along th | Success Stories | zillionpals.com
Mar 20, 2025 - I went to the market today for a specific task, but along the way, I remembered a couple of other pending things. Instead of postponing them, I decided to get...
to themarket todaysuccess storiesspecifictask
https://www.nwcg.gov/agency-specific-position-task-books?combine=&order=name_2&sort=asc
Agency Specific Position Task Books | NWCG
The following are agency specific Position Task Books (PTBs). These PTBs are not produced or
agencyspecificpositiontaskbooks
https://www.managementsolutions.com/fr/publications-and-events/events/university/llm-specialisation-towards-task-and-domain-specific-optimisation
LLM specialisation: Towards task- and domain-specific optimisation - Management Solutions
The iDanae Chair (intelligence, data, analysis, and strategy) in Big Data and Analytics, created within the framework of collaboration between the Technical
management solutionsllmspecialisationtowardstask
https://ielts.net/importance-of-diversifying-investment-portfolios/
IELTS Writing Task 2: Sample Essays On Investment Portfolio Diversification - Band-specific...
May 24, 2025 - Explore expert insights on the importance of diversifying investment portfolios with detailed IELTS essay examples. Learn key strategies and analysis for...
ielts writingsample essaysinvestment portfoliotaskdiversification
https://oneuptime.com/blog/post/2026-02-21-ansible-start-playbook-specific-task/view
How to Start Ansible Playbook at a Specific Task
Feb 21, 2026 - Learn how to use the start-at-task option to resume Ansible playbook execution from a specific task, saving time during debugging and reruns.
how to startansibleplaybookspecifictask
https://www.mdpi.com/2227-9059/11/9/2460
Gender-Specific Interactions in a Visual Object Recognition Task in Persons with Opioid Use Disorder
Opioid use disorder (OUD)-associated overdose deaths have reached epidemic proportions worldwide over the past two decades, with death rates for men reported...
opioid use disorderin aobject recognitiongenderspecific
https://www.rohan-paul.com/p/int-instance-specific-negative-mining
"INT: Instance-Specific Negative Mining for Task-Generic Promptable Segmentation"
Below podcast on this paper is generated with Google's Illuminate.
intinstancespecificnegativemining
https://lkml.indiana.edu/2010.3/11132.html
Linux-Kernel Archive: [PATCH 5.9 08/74] io_uring: enable task/files specific overflow flushing
linux kernelarchivepatchioenable
https://www.nextgov.com/artificial-intelligence/2024/12/house-ai-task-force-recommends-sector-specific-regs-final-report/401731/?oref=ng-topic-lander-featured-river
House AI Task Force recommends sector-specific regs in final report - Nextgov/FCW
The document aims to balance keeping the U.S. competitive in AI innovation and adoption while mitigating negative outcomes.
ai task forcesector specificfinal reporthouserecommends
https://support.apple.com/en-sa/guide/remote-desktop/apd5a6e556a/mac
Restrict clients to a specific Remote Desktop Task Server - Apple Support (SA)
You can restrict clients to take instructions only from a specified Task Server.
remote desktopapple supportrestrictclientsspecific
https://homeworkmavens.com/it-managers-often-decide-to-use-overseas-workers-to-accomplish-a-specific-task-or-run-a-specific-area-of-it-for-example-a-help-desk-or-network/
IT managers often decide to use overseas workers to accomplish a specific task or run a specific...
Nov 16, 2024 - Get on-demand help with homework questions, essays, assignments, and test prep from expert tutors to pass your classes with better grades.
it managersoftendecideuseoverseas
https://succorely.com/for-this-task-you-will-develop-a-personal-brand-statement-that-supports-your-smart-specific-measurable-achievable-relevant-and-timely-career-goal-based-on-your-personal-interests-skills-and-s/
For this task, you will develop a personal brand statement that supports your SMART (specific,...
personal brandtaskdevelopstatementsupports
https://community.smartsheet.com/discussion/133031/how-do-i-structure-formulas-so-that-i-receive-a-specific-count-back-regarding-task-status
How do I structure formulas so that I receive a specific count back regarding Task Status? -...
The Smartsheet above is referenced by multiple members of my organization, but I'd like to simplify some of the information for the members who only want to...
how do iso thattask statusstructureformulas
https://bytez.com/docs/arxiv/1808.00423/paper
Seq2Seq and Multi-Task Learning for joint intent and content extraction for domain specific...
Aug 1, 2018 - The 2018 paper explores using advanced techniques called Seq2Seq and Multi-Task Learning to help computer programs understand and respond to user requests...
learning forcontent extractionmultitaskjoint