Robuta

https://www.sie.gov.hk/en/what-we-do/research/detail/modular_prosthetics_w_interchanging_task-specific_tools_for_upper_limb_amputeesd41d.html Modular Prosthetics with Interchanging Task-Specific Tools for Upper Limb Amputees - Research - SIE... task specificupper limbmodularprostheticstools https://research-repository.uwa.edu.au/en/projects/the-influence-of-group-size-on-task-specific-intervention-in-chil-2/ The Influence of Group Size on Task Specific Intervention in Children with Coordination... the influenceon taskgroupsizespecific https://researchconnect.buffalo.edu/en/publications/convergence-of-meta-learning-with-task-specific-adaptation-over-p/ Convergence of meta-learning with task-specific adaptation over partial parameters - SUNY... task specificconvergencemetalearningadaptation https://pure.canterbury.ac.uk/en/publications/task-specific-short-powerpointstm-for-effective-off-campus-learni-2/ Task-specific short PowerPointsTM for effective off-campus learning in diagnostic radiography -... task specificoff campusshorteffectivelearning https://www.azolifesciences.com/news/20251017/Task-Specific-Machine-Learning-Architecture-Enhances-Drug-Discovery-Accuracy.aspx Task-Specific Machine Learning Architecture Enhances Drug Discovery Accuracy Oct 17, 2025 - The drug development pipeline is a costly and lengthy process. Identifying high-quality "hit" compounds-those with high potency, selectivity, and favorable... task specificmachine learningdrug discoveryarchitectureaccuracy https://www.dulyhealthandcare.com/conditions/work-task-specific-training Work Task Specific Training | Duly Health and Care health and caretask specificworktraining https://tldr.chat/technology/effective-evaluation-strategies-for-task-specific-language-models-525a Effective Evaluation Strategies for Task-Specific Language Models - TL;DR.Chat Evaluating task-specific language models (LLMs) can be challenging, especially when off-the-shelf evaluation metrics often fail to correlate with performance in task specificlanguage modelseffectiveevaluationstrategies https://irf.fhnw.ch/entities/publication/f9f57c07-86da-4916-a52f-ea0263b87d43 Sustainability of general-purpose AI versus task-specific models Artificial Intelligence (AI) relies on significant energy resources, raising questions about its environmental sustainability, especially as adoption grows in... general purposeai versustask specificsustainabilitymodels https://www.amazon.science/code-and-datasets/automated-evaluation-of-retrieval-augmented-language-models-with-task-specific-exam-generation Automated evaluation of retrieval-augmented language models with task-specific exam generation -... We propose a new method to measure the task-specific accuracy of Retrieval-Augmented Large Language Models (RAG). Evaluation is performed by scoring the RAG on... language modelstask specificautomatedevaluationretrieval https://demo.ever.works/items/40-task-specific-ai-agents-prediction 40% Task-Specific AI Agents Prediction | Ever Works Gartner predicts that 40% of enterprise applications will leverage task-specific AI agents by 2026, compared to less than 5% in 2025, representing a major sh... task specificai agentspredictioneverworks https://www.bringmark.com/faqs/what-percentage-of-enterprise-apps-will-use-task-specific-ai-agents-by-2026 What percentage of enterprise apps will use task-specific AI agents by 2026? | FAQs | Bringmark Gartner predicts that 40 percent of enterprise apps will use task-specific AI agents by 2026. However, the actual number in production will depend on how... enterprise appstask specificai agentspercentageuse https://dataphoenix.info/announcement-of-jurassic-2-and-task-specific-apis/ Announcement of Jurassic-2 and Task-Specific APIs Mar 17, 2023 - AI21 Studio has announced the launch of the latest generation of base models that have changed the artificial intelligence landscape, providing the highest... task specificannouncementjurassicapis https://pubmed.ncbi.nlm.nih.gov/34293643/ Computer Game Assisted Task Specific Exercises in the Treatment of Motor and Cognitive Function and... CGATSE may be beneficial in providing continuation of care after stroke, especially during the Covid-19 pandemic when home based rehabilitation options are... computer gametask specificthe treatmentcognitive functionassisted https://repository.arizona.edu/handle/10150/311799 Short-Term Benefits of Research-Based, Task-Specific Exercises in a Group Setting for People with... benefits of researchshort termtask specificfor peoplebased https://openhsu.ub.hsu-hh.de/entities/publication/16698 Transient, sustained, and task-specific non-perceptual conflict adjustment task specifictransientsustainednonconflict https://incident-prevention.com/blog/understanding-task-specific-training/ Understanding Task-Specific Training - Incident Prevention Sep 19, 2023 - If an employer must defend their company in the event of an incident or accident, training records are a critical tool. There is nothing better to present... task specificunderstandingtrainingincidentprevention https://knova.um.edu.my/research_publications_2021_2025/7549/ "Pd on a novel nitrogen doped porous carbon derived from task specific " by Masoumeh Dorraj, Samahe... In attempt to develop low-cost biomass derived carbon materials with improved properties, herein we present a facile method for the fabrication of nitrogen... on atask specificpdnovelnitrogen https://dc.ewu.edu/srcw_2026/works_2026/works_2026/4/ EWU Digital Commons - 2026 Symposium: Evaluating Small, Task-Specific LLMs for Reconnaissance in... Vulnerability identification during penetration testing traditionally relies on rigid string-matching to map network scan data to Common Platform Enumeration... digital commonstask specificewusymposiumevaluating https://itcon.org/paper/2015/7 ITcon paper: BIM on the construction site: providing hidden information on task specific drawings... Journal of Information Technology in Construction the construction sitetask specificitconpaperbim https://researchr.org/publication/CaoZCGW23 Task-Specific Feature Purifying in Radar-Based Human Pose Estimation - researchr publication human pose estimationtask specificfeaturepurifyingradar https://medlineplus.gov/genetics/condition/task-specific-focal-dystonia/ Task-specific focal dystonia: MedlinePlus Genetics Task-specific focal dystonia is a movement disorder that interferes with the performance of particular tasks, such as writing, playing a musical instrument, or... task specificfocaldystoniamedlineplusgenetics https://papers.neurips.cc/paper_files/paper/2025/hash/12678c3948153f4bc391f51e2082bd6e-Abstract-Conference.html Energy Landscape-Aware Vision Transformers: Layerwise Dynamics and Adaptive Task-Specific Training... task specificenergylandscapeawarevision https://cme.utsouthwestern.edu/129-032019 129 Neurology Grand Rounds: "Athletes with the Yips: Evidence for a Task-Specific Dystonia"... grand roundstask specificneurologyathletesyips https://elifesciences.org/articles/13141 Distributed task-specific processing of somatosensory feedback for voluntary motor control | eLife Somatosensory feedback is transmitted to many sensory and motor cortical regions within 25 milliseconds and ongoing behavioural tasks alter the spatiotemporal... task specificmotor controldistributedprocessingsomatosensory https://www.frontiersin.org/journals/neurology/articles/10.3389/fneur.2017.00170/full Frontiers | Research Priorities in Limb and Task-Specific Dystonias Dystonia, which causes intermittent or sustained abnormal postures and movements, can present in a focal or a generalized manner. In the limbs, focal dystoni... research prioritiestask specificfrontierslimbdystonias https://scholars.hkbu.edu.hk/en/publications/task-specific-balance-training-improves-the-sensory-organisation--2/fingerprints/ Task-Specific Balance Training Improves the Sensory Organisation of Balance Control in Children... task specificbalance trainingimprovessensoryorganisation https://ideas.repec.org/a/spr/jlabrs/v46y2013i3d10.1007_s12651-013-0145-y.html Why to employ both migrants and natives? A study on task-specific substitutability [Warum... Downloadable! This paper analyses the performance of migrants on the German labour market and its dependence on the tasks performed on their jobs. Recent work... a studyon taskemploymigrantsnatives https://openreview.net/forum?id=JDmAymuFFQ FL-TAC: Enhanced Fine-Tuning in Federated Learning via Low-Rank, Task-Specific Adapter Clustering |... Although large-scale pre-trained models hold great potential for adapting to downstream tasks through fine-tuning, the performance of such fine-tuned models is... fine tuningfederated learningtask specificfltac https://impact.ornl.gov/en/publications/separation-of-fission-products-based-on-ionic-liquids-task-specif/ Separation of fission products based on ionic liquids: Task-specific ionic liquids containing an... based onionic liquidstask specificseparationfission https://liner.com/review/jsigan-ganbased-joint-superresolution-and-inverse-tonemapping-with-pixelwise-taskspecific JSI-GAN: GAN-Based Joint Super-Resolution and Inverse Tone-Mapping with Pixel-Wise Task-Specific... Regarding this AAAI 2019 paper, this review summarizes JSI-GAN, a novel GAN for joint super-resolution and inverse tone-mapping of UHD HDR video. super resolutiontask specificjsiganbased https://pure.eur.nl/en/publications/self-regulated-learning-validating-a-task-specific-questionnaire-/ Self-regulated learning: Validating a task-specific questionnaire for children in elementary school... a taskfor childrenelementary schoolselfregulated https://underline.io/lecture/25394-improving-the-faithfulness-of-attention-based-explanations-with-task-specific-information-for-text-classification Improving the Faithfulness of Attention-based Explanations with Task-specific Information for Text... On-demand video platform giving you access to lectures from conferences worldwide. task specificinformation forimprovingfaithfulnessattention https://pure.seoultech.ac.kr/en/publications/task-specific-preconditioner-for-cross-domain-few-shot-learning/ Task-Specific Preconditioner for Cross-Domain Few-Shot Learning - Seoul National University of... seoul national universitytask specificcross domainshotlearning https://www.toolai.io/ai/airops AirOps - Task-specific AI Apps that take you... - ToolAI.io task specificai appsairopstakeio https://cris.haifa.ac.il/en/publications/task-specific-rapid-auditory-perceptual-learning-in-adult-cochlea/ Task-Specific Rapid Auditory Perceptual Learning in Adult Cochlear Implant Recipients: What Could... task specificcochlear implantrapidauditorylearning https://scholars.mssm.edu/en/publications/adult-onset-idiopathic-focal-lower-extremity-dystonia-a-rare-task-3/ Adult-onset idiopathic focal lower extremity dystonia: A rare task-specific dystonia - Icahn School... lower extremitytask specificadultonsetfocal https://www.eneuro.org/content/7/4/ENEURO.0512-19.2019 Decoding Task-Specific Cognitive States with Slow, Directed Functional Networks in the Human Brain... Flexible functional interactions among brain regions mediate critical cognitive functions. Such interactions can be measured using functional magnetic... the human braintask specificdecodingcognitivestates https://iris.sissa.it/handle/20.500.11767/16972 Nouns and verbs in the brain: Grammatical class and task specific effects as revealed by fMRI the braintask specificnounsverbsclass https://research.utwente.nl/en/publications/extracted-species-of-npiv-complex-with-diglycolamide-functionaliz/ Extracted species of Np(IV) complex with diglycolamide functionalized task specific ionic liquid:... task specificextractedspeciesnpiv https://ircommons.uwf.edu/esploro/outputs/journalArticle/If-at-First-You-Dont-Succeed/99380576890806600 If at First You Don't Succeed: Effects of Failure on General and Task-Specific Self-Efficacy and... Mar 1, 2006 - This study explored the impact that failing a specific cognitive task had on self-efficacy and future task performance. Participants were 60 university... task specificfirstsucceedeffectsfailure https://pure.ul.ie/en/publications/enhancing-task-specific-distillation-in-small-data-regimes-throug/fingerprints/?sortBy=alphabetically Enhancing Task-Specific Distillation in Small Data Regimes through Language Generation -... task specificenhancingdistillationsmalldata https://www.techscience.com/cmc/v87n3/66960/pdf CMC | Task-Specific YOLO Optimization for Railway Tunnel Cracks and Water Leakage: Benchmarking and... The safe operation of railway systems necessitates efficient and automated inspection of tunnel defects. While deep learning offers solutions, a clear pathway... task specificwater leakagecmcyolooptimization https://www.zillionpals.com/group/success-stories/discussion/ad3f27fe-cda5-4a5c-bfa5-066a8f4476ff I went to the market today for a specific task, but along th | Success Stories | zillionpals.com Mar 20, 2025 - I went to the market today for a specific task, but along the way, I remembered a couple of other pending things. Instead of postponing them, I decided to get... to themarket todaysuccess storiesspecifictask https://www.nwcg.gov/agency-specific-position-task-books?combine=&order=name_2&sort=asc Agency Specific Position Task Books | NWCG The following are agency specific Position Task Books (PTBs). These PTBs are not produced or agencyspecificpositiontaskbooks https://www.managementsolutions.com/fr/publications-and-events/events/university/llm-specialisation-towards-task-and-domain-specific-optimisation LLM specialisation: Towards task- and domain-specific optimisation - Management Solutions The iDanae Chair (intelligence, data, analysis, and strategy) in Big Data and Analytics, created within the framework of collaboration between the Technical management solutionsllmspecialisationtowardstask https://ielts.net/importance-of-diversifying-investment-portfolios/ IELTS Writing Task 2: Sample Essays On Investment Portfolio Diversification - Band-specific... May 24, 2025 - Explore expert insights on the importance of diversifying investment portfolios with detailed IELTS essay examples. Learn key strategies and analysis for... ielts writingsample essaysinvestment portfoliotaskdiversification https://oneuptime.com/blog/post/2026-02-21-ansible-start-playbook-specific-task/view How to Start Ansible Playbook at a Specific Task Feb 21, 2026 - Learn how to use the start-at-task option to resume Ansible playbook execution from a specific task, saving time during debugging and reruns. how to startansibleplaybookspecifictask https://www.mdpi.com/2227-9059/11/9/2460 Gender-Specific Interactions in a Visual Object Recognition Task in Persons with Opioid Use Disorder Opioid use disorder (OUD)-associated overdose deaths have reached epidemic proportions worldwide over the past two decades, with death rates for men reported... opioid use disorderin aobject recognitiongenderspecific https://www.rohan-paul.com/p/int-instance-specific-negative-mining "INT: Instance-Specific Negative Mining for Task-Generic Promptable Segmentation" Below podcast on this paper is generated with Google's Illuminate. intinstancespecificnegativemining https://lkml.indiana.edu/2010.3/11132.html Linux-Kernel Archive: [PATCH 5.9 08/74] io_uring: enable task/files specific overflow flushing linux kernelarchivepatchioenable https://www.nextgov.com/artificial-intelligence/2024/12/house-ai-task-force-recommends-sector-specific-regs-final-report/401731/?oref=ng-topic-lander-featured-river House AI Task Force recommends sector-specific regs in final report - Nextgov/FCW The document aims to balance keeping the U.S. competitive in AI innovation and adoption while mitigating negative outcomes. ai task forcesector specificfinal reporthouserecommends https://support.apple.com/en-sa/guide/remote-desktop/apd5a6e556a/mac Restrict clients to a specific Remote Desktop Task Server - Apple Support (SA) You can restrict clients to take instructions only from a specified Task Server. remote desktopapple supportrestrictclientsspecific https://homeworkmavens.com/it-managers-often-decide-to-use-overseas-workers-to-accomplish-a-specific-task-or-run-a-specific-area-of-it-for-example-a-help-desk-or-network/ IT managers often decide to use overseas workers to accomplish a specific task or run a specific... Nov 16, 2024 - Get on-demand help with homework questions, essays, assignments, and test prep from expert tutors to pass your classes with better grades. it managersoftendecideuseoverseas https://succorely.com/for-this-task-you-will-develop-a-personal-brand-statement-that-supports-your-smart-specific-measurable-achievable-relevant-and-timely-career-goal-based-on-your-personal-interests-skills-and-s/ For this task, you will develop a personal brand statement that supports your SMART (specific,... personal brandtaskdevelopstatementsupports https://community.smartsheet.com/discussion/133031/how-do-i-structure-formulas-so-that-i-receive-a-specific-count-back-regarding-task-status How do I structure formulas so that I receive a specific count back regarding Task Status? -... The Smartsheet above is referenced by multiple members of my organization, but I'd like to simplify some of the information for the members who only want to... how do iso thattask statusstructureformulas https://bytez.com/docs/arxiv/1808.00423/paper Seq2Seq and Multi-Task Learning for joint intent and content extraction for domain specific... Aug 1, 2018 - The 2018 paper explores using advanced techniques called Seq2Seq and Multi-Task Learning to help computer programs understand and respond to user requests... learning forcontent extractionmultitaskjoint