Robuta

https://pubchem.ncbi.nlm.nih.gov/protein/Q980H6 Flavin-dependent thymidylate synthase (Saccharolobus solfataricus P2) | Protein Target - PubChem Protein target information for Flavin-dependent thymidylate synthase (Saccharolobus solfataricus P2). Find diseases associated with this biological target and... thymidylate synthaseflavindependentproteintarget https://www.ncbi.nlm.nih.gov/Structure/pdb/5X4W 5X4W: Mutant human thymidylate synthase A191K crystallized in a sulfate-free condition Thymidylate synthasePHOSPHATE ION thymidylate synthase https://pubchem.ncbi.nlm.nih.gov/protein/Q5M0S7 Thymidylate synthase (Streptococcus thermophilus CNRZ1066) | Protein Target - PubChem Protein target information for Thymidylate synthase (Streptococcus thermophilus CNRZ1066). Find diseases associated with this biological target and compounds... thymidylate synthasestreptococcus thermophilusproteintargetpubchem https://www.ncbi.nlm.nih.gov/Structure/pdb/3IRM 3IRM: Trypanosoma cruzi Dihydrofolate Reductase-Thymidylate Synthase COMPLEXED WITH Cycloguanil Bifunctional dihydrofolate reductase-thymidylate synthase1-(4-chlorophenyl)-6,6-dimethyl-1,6-dihydro-1,3,5-triazine-2,4-diamineACETATE IONPHOSPHATE ION trypanosoma cruzithymidylate synthasereductase https://pubchem.ncbi.nlm.nih.gov/protein/1JMG_A Chain A, Thymidylate Synthase (Lacticaseibacillus casei) | Protein Target - PubChem Protein target information for Chain A, Thymidylate Synthase (Lacticaseibacillus casei). Find diseases associated with this biological target and compounds... thymidylate synthasechainlacticaseibacillusproteintarget https://eprints.ncl.ac.uk/120476 Mechanism of cell-death following thymidylate synthase inhibition - 2'-deoxyuridine-5'-triphosphate... cell deaththymidylate synthase https://pubchem.ncbi.nlm.nih.gov/protein/Q9A6H0 Thymidylate synthase (Caulobacter vibrioides CB15) | Protein Target - PubChem Protein target information for Thymidylate synthase (Caulobacter vibrioides CB15). Find diseases associated with this biological target and compounds tested... thymidylate synthaseproteintargetpubchem https://diposit.ub.edu/items/f36ae7df-1d50-4460-a27a-4086ca4fc33a/full Association of thymidylate synthase polymorphisms with acute pancreatitis and/or peripheral... BACKGROUND: Low expression thymidylate synthase (TS) polymorphism has been associated with increased stavudine triphosphate intracellular (d4T-TP) levels and... thymidylate synthaseacute pancreatitisassociation https://www.ncbi.nlm.nih.gov/protein/1EVF_A Chain A, THYMIDYLATE SYNTHASE - Protein - NCBI thymidylate synthasechainproteinncbi https://pubmed.ncbi.nlm.nih.gov/39544745/?dopt=Abstract Unveiling the oncogenic significance of thymidylate synthase in human cancers This study furnishes a comprehensive understanding of the oncogenic role played by TYMS in human tumors. thymidylate synthasein humanunveilingsignificancecancers https://pubchem.ncbi.nlm.nih.gov/protein/Q582G3 Bifunctional dihydrofolate reductase-thymidylate synthase (Trypanosoma brucei brucei TREU927) |... Protein target information for Bifunctional dihydrofolate reductase-thymidylate synthase (Trypanosoma brucei brucei TREU927). Find diseases associated with... thymidylate synthasebifunctionalreductasetrypanosoma https://pubchem.ncbi.nlm.nih.gov/protein/A5EVG5 Thymidylate synthase (Dichelobacter nodosus VCS1703A) | Protein Target - PubChem Protein target information for Thymidylate synthase (Dichelobacter nodosus VCS1703A). Find diseases associated with this biological target and compounds tested... thymidylate synthaseproteintargetpubchem https://pubchem.ncbi.nlm.nih.gov/protein/P09249 Thymidylate synthase (Human herpesvirus 3 strain Dumas) | Protein Target - PubChem Protein target information for Thymidylate synthase (Human herpesvirus 3 strain Dumas). Find diseases associated with this biological target and compounds... thymidylate synthasehumanherpesvirusstraindumas https://pubchem.ncbi.nlm.nih.gov/protein/Q5P233 Thymidylate synthase (Aromatoleum aromaticum EbN1) | Protein Target - PubChem Protein target information for Thymidylate synthase (Aromatoleum aromaticum EbN1). Find diseases associated with this biological target and compounds tested... thymidylate synthaseproteintargetpubchem https://pubchem.ncbi.nlm.nih.gov/protein/A8H1B4 Thymidylate synthase (Shewanella pealeana ATCC 700345) | Protein Target - PubChem Protein target information for Thymidylate synthase (Shewanella pealeana ATCC 700345). Find diseases associated with this biological target and compounds... thymidylate synthaseatccproteintargetpubchem https://experts.arizona.edu/en/publications/pairwise-specificity-and-sequential-binding-in-enzyme-catalysis-t/ Pairwise Specificity and Sequential Binding in Enzyme Catalysis: Thymidylate Synthase - University... enzyme catalysisthymidylate synthasepairwisespecificitysequential https://pubchem.ncbi.nlm.nih.gov/protein/A1UTA5 Thymidylate synthase (Bartonella bacilliformis KC583) | Protein Target - PubChem Protein target information for Thymidylate synthase (Bartonella bacilliformis KC583). Find diseases associated with this biological target and compounds tested... thymidylate synthasebartonellaproteintargetpubchem https://www.ncbi.nlm.nih.gov/Structure/pdb/7XYJ 7XYJ: Structure of WSSV thymidylate synthase in complex with dUMP Thymidylate synthase2'-DEOXYURIDINE 5'-MONOPHOSPHATEPENTAETHYLENE GLYCOLSULFATE ION thymidylate synthasestructurecomplexdump https://pubchem.ncbi.nlm.nih.gov/protein/Q0VM06 Thymidylate synthase (Alcanivorax borkumensis SK2) | Protein Target - PubChem Protein target information for Thymidylate synthase (Alcanivorax borkumensis SK2). Find diseases associated with this biological target and compounds tested... thymidylate synthaseproteintargetpubchem https://pubchem.ncbi.nlm.nih.gov/protein/A4W0V3 Thymidylate synthase (Streptococcus suis 98HAH33) | Protein Target - PubChem Protein target information for Thymidylate synthase (Streptococcus suis 98HAH33). Find diseases associated with this biological target and compounds tested... thymidylate synthasestreptococcus suisproteintargetpubchem https://www.ncbi.nlm.nih.gov/Structure/pdb/4UP1 4UP1: Crystal structure of native human Thymidylate synthase in active form THYMIDYLATE SYNTHASESULFATE ION crystal structurethymidylate synthasenative https://pubchem.ncbi.nlm.nih.gov/protein/A4VUL1 Thymidylate synthase (Streptococcus suis 05ZYH33) | Protein Target - PubChem Protein target information for Thymidylate synthase (Streptococcus suis 05ZYH33). Find diseases associated with this biological target and compounds tested... thymidylate synthasestreptococcus suisproteintargetpubchem https://pubchem.ncbi.nlm.nih.gov/protein/B6JB67 Thymidylate synthase (Afipia carboxidovorans OM5) | Protein Target - PubChem Protein target information for Thymidylate synthase (Afipia carboxidovorans OM5). Find diseases associated with this biological target and compounds tested... thymidylate synthaseproteintargetpubchem https://www.ncbi.nlm.nih.gov/protein/3N0C_C Chain C, Thymidylate synthase thyX - Protein - NCBI thymidylate synthasechainproteinncbi https://www.ncbi.nlm.nih.gov/Structure/pdb/1HVY 1HVY: Human thymidylate synthase complexed with dUMP and Raltitrexed, an antifolate drug, is in the... THYMIDYLATE SYNTHASE2'-DEOXYURIDINE 5'-MONOPHOSPHATEBETA-MERCAPTOETHANOLTOMUDEX https://experts.arizona.edu/en/datasets/1tlc-thymidylate-synthase-complexed-with-dgmp-and-folate-analog-1/ 1TLC : THYMIDYLATE SYNTHASE COMPLEXED WITH DGMP AND FOLATE ANALOG 1843U89 - University of Arizona https://experts.arizona.edu/en/publications/promotion-of-purine-nucleotide-binding-to-thymidylate-synthase-by/ Promotion of purine nucleotide binding to thymidylate synthase by a potent folate analogue... https://experts.arizona.edu/en/publications/role-of-an-invariant-lysine-residue-in-folate-binding-on-escheric/ Role of an invariant lysine residue in folate binding on Escherichia coli thymidylate synthase:... https://www.ncbi.nlm.nih.gov/Structure/pdb/6PF5 6PF5: Crystal structure of human thymidylate synthase Delta (7-29) in complex with dUMP and... Thymidylate synthase2'-DEOXYURIDINE... https://boris-portal.unibe.ch/entities/publication/23e6a841-e663-433b-8cab-f27857986fe4 A Novel Nomenclature for Repeat Motifs in the Thymidylate Synthase Enhancer Region and Its... Inhibition of thymidylate synthase (TS) is the primary mode of action for 5-fluorouracil (5FU) chemotherapy. TS expression is modulated by a variable number of... https://pubmed.ncbi.nlm.nih.gov/3008760/?dopt=Abstract Relationship between 5-fluoro-2'-deoxyuridylate, 2'-deoxyuridylate, and thymidylate synthase... 5-Fluorouracil (FUra) has been administered to mice bearing xenografts of human colon adenocarcinomas. In two tumor lines, HxGC3 and HxVRC5, intrinsically... relationshipfluoro https://www-ssrl.slac.stanford.edu/content/science/highlight/2012-09-24/folate-binding-site-flavin-dependant-thymidylate-synthase-and Folate Binding Site of Flavin-dependant Thymidylate Synthase and the Mechanistic Implications |... Flavin-dependant thymidylate synthases (FDTSs) are a class of recently identified family of thymidylate synthases that employ novel mechanism for the... binding site https://eprints.ncl.ac.uk/17767 Induction of remission in hepatocellular carcinoma with a new thymidylate synthase inhibitor,... hepatocellular carcinoma https://www.ncbi.nlm.nih.gov/Structure/pdb/1F4D 1F4D: CRYSTAL STRUCTURE OF E. COLI THYMIDYLATE SYNTHASE C146S, L143C COVALENTLY MODIFIED AT C143... THYMIDYLATE SYNTHASEGLYCEROLN-[TOSYL-D-PROLINYL]AMINO-ETHANETHIOLSULFATE ION https://experts.arizona.edu/en/publications/promotion-of-purine-nucleotide-binding-to-thymidylate-synthase-by/fingerprints/ Promotion of purine nucleotide binding to thymidylate synthase by a potent folate analogue...