Robuta

https://stacks.cdc.gov/view/cdc/112657 Balancing sensitivity and specificity of Zika virus case definitions zika viruscase definitionsbalancingsensitivityspecificity https://scholars.duke.edu/publication/938895 Scholars@Duke publication: Sodium Coupling and Nucleoside Specificity of a Concentrative Nucleoside... scholarsdukepublicationsodiumcoupling https://researchportal.ip-paris.fr/fr/publications/editorial-expression-of-concern-identification-of-oncogenic-micro/ Editorial Expression of Concern: Identification of oncogenic microRNA-17-92/ZBTB4/specificity... expression of concerneditorialidentificationmicrornaspecificity https://research.uni-luebeck.de/de/publications/outcome-of-limbic-encephalitis-with-vgkc-complex-antibodies-relat/ Outcome of limbic encephalitis with VGKC-complex antibodies: Relation to antigenic specificity -... limbic encephalitisoutcomecomplexantibodiesrelation https://pmc.ncbi.nlm.nih.gov/articles/PMC10834125/ Sensitivity and Specificity of the Boston Criteria Version 2.0 for the Diagnosis of Cerebral... The Boston criteria are a set of clinical and neuroimaging features that enable accurate diagnosis of cerebral amyloid angiopathy (CAA) without invasive... sensitivityspecificitybostoncriteriaversion https://ricerca.uniba.it/handle/11586/116117 Endothelial cell heterogeneity and organ specificity cellheterogeneityorganspecificity https://mider.openrepository.com/items/f5bd5927-82d4-42e8-9820-afbb7d064628 Specificity and sensitivity of the social communication questionnaire lifetime screening tool for... INTRODUCTION: The Social Communication Questionnaire is used to identify children and young people (CYP) who may require formal ASD assessment. However, there... the socialscreening toolspecificitysensitivitycommunication https://experts.mcmaster.ca/scholarly-works/1614032 Progressive Thresholding: Shaping and Specificity... Learn about the scholarly work entitled Progressive Thresholding: Shaping and Specificity... progressivethresholdingshapingspecificity https://cris.bgu.ac.il/en/publications/host-specificity-and-geographic-range-in-haematophagous-ectoparas/ Host specificity and geographic range in haematophagous ectoparasites - Ben-Gurion University... hostspecificitygeographicrangeectoparasites https://research.hub.ku.edu.tr/entities/publication/5fa86329-da70-46b3-a8f2-048e4966c158 Early language-specificity of children's event encoding in speech and gesture: evidence from caused... Previous research on language development shows that children are tuned early on to the language-specific semantic and syntactic encoding of events in their... earlylanguagespecificitychildrenevent https://research.manchester.ac.uk/en/publications/sensitivity-and-specificity-of-ftdc-criteria-for-behavioral-varia/ Sensitivity and specificity of FTDC criteria for behavioral variant frontotemporal dementia. -... frontotemporal dementiasensitivityspecificitycriteriabehavioral https://herseninstituut.nl/publicaties/specificity-of-oxytocin-and-vasopressin-immuno-fluorescence/ Specificity of oxytocin and vasopressin- immuno- fluorescence - Nederlands Herseninstituut - KNAW |... specificityoxytocinvasopressinimmunofluorescence https://brookbushinstitute.com/glossary/specificity/ Specificity - Brookbush Institute Specificity is a critical aspect of medical testing that measures the probability of a negative test result in someone without a particular pathology. A highly... specificityinstitute https://web.dev/learn/css/specificity?authuser=002 Specificity | web.dev 'This module takes a deeper look at specificity, a key part of the cascade.' web devspecificity https://www.wikidata.org/wiki/Q39505497 Expression of a Forssman antigenic specificity in the preimplantation mouse embryo - Wikidata scientific article published on August 1, 1978 expressionspecificitymouseembryowikidata https://www.esiservizi.com/2025/09/18/recombinant-human-cleavage-and-polyadenylation-specificity-factor-subunit-4-cpsf4/ Recombinant Human Cleavage and polyadenylation specificity factor subunit 4 (CPSF4) | esiservizi.com Sep 18, 2025 - Product Name : Recombinant Human Cleavage and polyadenylation specificity factor subunit 4 (CPSF4)TargetID : O95639Source : E.coliGene Accession Number :... recombinanthumancleavagespecificityfactor https://pascal-francis.inist.fr/vibad/index.php?action=getRecordDetail&idt=3884099 Substrate specificity of proinsulin conversion in the constitutive pathway of transfected FAO... substratespecificityproinsulinconversionpathway https://en.delachieve.com/what-cases-does-the-justice-of-the-peace-consider-specificity-of-activity/ What cases does the justice of the peace consider? Specificity of activity the justicecasespeaceconsiderspecificity https://file.scirp.org/Html/2-2420237_85011.htm Sensitivity and Specificity of a Short Questionnaire to Screen Frailty in the Community-Dwelling... Introduction. Frailty represents a major risk factor for death and Use of Hospital Services (UHS) among older adults. A simple tool to detect frailty might... in the communityshort questionnairesensitivityspecificityscreen https://www.ideals.illinois.edu/items/85577 The Development and Application of Methods to Study the Evolution of Specificity, Allostery, and... the developmentapplicationmethodsstudyevolution https://repun-app.fish.hokudai.ac.jp/mod/page/view.php?id=1982&lang=ja protein and peptide: Substrate specificity | LASBOS Moodle proteinpeptidesubstratespecificitymoodle https://db.cngb.org/data_resources/protein/A0A2T0LQL1 Broad specificity phosphatase PhoE - Protein - Data resources - CNGBdb A0A2T0LQL1; Broad specificity phosphatase PhoE; A0A2T0LQL1_9PSEU data resourcesbroadspecificityphosphatasephoe https://bugfree.ai/knowledge-hub/the-power-of-specificity-in-behavioral-storytelling The Power of Specificity in Behavioral Storytelling - Behavior Interview Guide | bugfree.ai Learn how to enhance your behavioral interview responses with the power of specificity. This article provides tips for software engineers and data scientists... the power ofinterview guidespecificitybehavioralstorytelling https://www.howtothink.ai/concepts/cue-specificity-the-degree-to-which-a-behavioral-trigger-is Cue specificity: the degree to which a behavioral trigger is | How to Think AI Cue specificity: the degree to which a behavioral trigger is defined with sufficient precision that the brain can recognize it automatically through pattern... the degreecuespecificitybehavioraltrigger https://www.upmc.com/media/news/pitt-team-redesigns-epilepsy-drug Pitt Team Redesigns Epilepsy Drug to Increase Potency and Specificity More effective version of an FDA-approved epilepsy drug with the potential for fewer side effects pittteamredesignsepilepsydrug https://lists.w3.org/Archives/Public/www-style/2002Sep/0040.html ambiguity? in specificity rules from Al Gilman on 2002-08-30 (www-style@w3.org from September 2002) ambiguityspecificityrulesalgilman https://art.torvergata.it/handle/2108/293364 A role of Gln596 in fine-tuning mammalian ALOX15 specificity, protein stability and allosteric... role offine tuningprotein stabilitymammalianspecificity https://yenra.com/i/ai20/non-invasive-prenatal-health-assessment/improved-sensitivity-and-specificity-3.html Improved Sensitivity and Specificity 3 Improved Sensitivity and Specificity: A high-tech medical scanner projecting overlapping transparent screens, each representing test outcomes. The screens... improvedsensitivityspecificity https://digitalcommons.georgiasouthern.edu/biostat-facpubs/179/ "Joint Inference about Sensitivity and Specificity at Optimal Cut-Off P" by Jingjing Yin and Lili... In diagnostic studies, both sensitivity and specificity depend on cut-off point and they are well-known measures for diagnostic accuracy. The diagnostic... cut offjointinferencesensitivityspecificity https://researchconnect.buffalo.edu/en/publications/detection-and-specificity-of-antibodies-secreted-by-spleen-cells-/ Detection and specificity of antibodies secreted by spleen cells in mice immunized with... spleen cellsdetectionspecificityantibodiesmice https://experts.arizona.edu/en/publications/procv-intcongrendocrinology-volii-specificity-of-cytosolic-and-nu-2/ PROC.V INT.CONGR.ENDOCRINOLOGY, VOL.II: specificity of cytosolic and nuclear receptors and... nuclear receptorsprocvintendocrinology https://polbase.neb.com/references/918 Polbase - Reference: Structural insight into the substrate specificity of DNA Polymerase mu. Structural insight into the substrate specificity of DNA Polymerase mu. dna polymerasereferencestructuralinsightsubstrate https://edoc.mdc-berlin.de/id/eprint/2663/ The human poliovirus receptor. Receptor-virus interaction and parameters of disease specificity -... the humanpoliovirusreceptorinteractionparameters https://www.eppendorf.com/fj-en/knowledge-hub/method-applications/molecular-biology/improve-yield-and-specificity-of-your-pcr-using-the-2d-gradient-function/ Improve Yield and Specificity of Your PCR Using the 2D-Gradient Function - Eppendorf South Asia... south asiaimproveyieldspecificitypcr https://opendentistryjournal.com/VOLUME/15/PAGE/551/FULLTEXT/ Sensitivity and Specificity of Mandibular Third Molar Calcification at Chronological Age and Hand... Sensitivity and Specificity of Mandibular Third Molar Calcification at Chronological Age and Hand Wrist Maturation Stage to Discriminate Between Female and... chronological agesensitivityspecificitythirdcalcification https://journals.univ-msila.dz/index.php/JTRLPS/article/view/5392 The specificity of combatting corruption during crises in Algerian penal law | The journal of... penal lawspecificitycorruptioncrisesalgerian https://www.affilorama.com/forum/website-building/problem-with-css-page-isn-t-taking-the-css-specificity-t916.html Problem with CSS - page isn't taking the CSS specificity | Website Building I am building my first site with CSS, and I am facing my first CSS problem ever! Here is what I've done so far: * ... website buildingproblemcsstakingspecificity https://elifesciences.org/reviewed-preprints/110491 Design and experimental characterization of specificity-switching mutational paths of WW domains designexperimentalcharacterizationspecificityswitching https://www.semanticscholar.org/topic/Antigenic-Specificity/2224204 Antigenic Specificity | Semantic Scholar semantic scholarspecificity https://scholars.cityu.edu.hk/en/publications/motif-composition-conservation-and-condition-specificity-of-singl/ Motif composition, conservation and condition-specificity of single and alternative transcription... motifcompositionconservationconditionspecificity https://air.unipr.it/handle/11381/2959541 Specificity and promiscuity in phosphoinositide binding by pleckstrin homology domains specificitypromiscuitybindinghomologydomains https://tensorflow.google.cn/versions/r2.0/api_docs/python/tf/compat/v1/metrics/sensitivity_at_specificity tf.compat.v1.metrics.sensitivity_at_specificity | TensorFlow v2.0.0 tfmetricssensitivityspecificitytensorflow https://www.quidelortho.com/es/es/resources/press-releases/barda-and-ortho-collaborate-to-advance-development-of-high-specificity-sars-cov-2-antibody-tests BARDA and Ortho Collaborate to Advance Development of High Specificity SARS-CoV-2 Antibody Tests |... antibody testsbardaorthocollaborateadvance https://pure.psu.edu/en/publications/a-principled-approach-to-reasoning-about-the-specificity-of-rules/ A Principled Approach to Reasoning about the Specificity of Rules - Penn State penn stateapproachreasoningspecificityrules https://hemostasistoday.com/voices/ifeanyichukwu-ifechidere-48501 Ifeanyichukwu Ifechidere: The Critical Role of Calibrator Specificity in Anticoagulation Monitoring... Apr 22, 2026 - Ifeanyichukwu Ifechidere: The Critical Role of Calibrator Specificity in Anticoagulation Monitoring / anti-Xa, Anticoagulation, Apixaban, dalteparin, DOAC, critical rolecalibratorspecificityanticoagulationmonitoring https://www.receptor.ai/proteins/a4d256 Dual specificity protein phosphatase CDC14C Dual specificity protein phosphatase CDC14C, also known as CDC14 cell division cycle 14 homolog C, plays a pivotal role in cellular processes by... dualspecificityproteinphosphatase https://www.mohrsiebeck.com/en/article/divided-we-stand-united-we-fall-asset-specificity-and-vertical-integration-reconsidered-101628093245612804469836/ Divided we Stand, United we Fall: Asset Specificity and Vertical Integration Reconsidered Recent surveys and casual observation suggest that higher levels of asset specificity need not always lead to vertical integration, as traditionally stressed... divided we standvertical integrationunitedfallasset https://www.daz3d.com/forums/discussion/25824/versatility-vs-specificity Versatility vs specificity - Daz 3D Forums Nice morph. Too bad it's for the female thing instead of Genesis. versatilityvsspecificitydazforums https://repo.journalnx.com/index.php/nx/article/view/904/875 View of SPECIFICITY OF GENDER AND POLITICAL LANGUAGE IN UZBEK AND ENGLISH viewspecificitygenderpoliticallanguage https://www.per-central.org/items/detail.cfm?ID=8117 The Specificity Effect: An Example from Refraction In physics instruction we often begin by presenting students with an abstract principle, and then illustrating the principle with one or more examples. We hope... an examplespecificityeffectrefraction https://rehabknowledge.com/forums/topic/sensitivity-vs-specificity/embed/ sensitivity vs specificity - Rehab Knowledge Advantage Can you give guidance on sensitivity vs specificity and sPin vs sNout? sensitivityvsspecificityrehabknowledge https://oa-fund.ub.uni-muenchen.de/id/eprint/1197/ Dynamics and stage-specificity of between-population gene expression divergence in the Drosophila... gene expressiondynamicsstagespecificitypopulation https://e-arm.org/journal/view.php?number=467&view=citations Age Specificity in General and Rehabilitation Medical Services in Children With Cerebral Palsy Annals of Rehabilitation Medicine (ARM) is an international, peer-reviewed open access journal which aims to share up-to-date knowledge dedicated to the... in generalmedical servicescerebral palsyagespecificity https://research.regionh.dk/en/publications/development-of-a-64cu-labeled-cd4-t-cell-targeting-pet-tracer-eva/ Development of a 64Cu-labeled CD4+ T cell targeting PET tracer: evaluation of CD4 specificity and... developmentlabeledcelltargetingpet https://pure.jbnu.ac.kr/en/publications/living-with-marginal-coral-communities-diversity-and-host-specifi/ Living with marginal coral communities: Diversity and host-specificity in coral-associated... living withmarginalcoralcommunitiesdiversity https://kidlit.com/scene-setting/ Specificity in Scene Setting | Kidlit Feb 10, 2023 - How much detail should you include in the description of your scene setting? Here are my tips for crafting a setting that'll draw readers into your story. specificityscenesetting https://www.cipsm.de/publications/research-area-d/structure-of-the-rna-helicase-mle-reveals-the-molecular-mechanisms-for-uridine-specificity-and-rna-atp-coupling-1/ CIPSM - Structure of the RNA Helicase MLE Reveals the Molecular Mechanisms for Uridine Specificity... structurernahelicasemlereveals https://perfilesycapacidades.javeriana.edu.co/es/publications/specificity-and-sensitivity-of-aquaporin-4-antibody-detection-tes/ Specificity and sensitivity of aquaporin 4 antibody detection tests in patients with neuromyelitis... in patientsspecificitysensitivityantibodydetection https://bibbase.org/network/publication/vinogradskaya-mosevitsky-studiesofthespontaneoustransformationspecificityinbacteriabacillussubtilisirelativelylowtransformationactivityofspontaneouslyreleaseddnaforgeneticmarkersplacedincellchromosomenearthepointsoforiginandterminationofthechromosomereplication-1979 Studies of the spontaneous transformation specificity in bacteria Bacillus subtilis. I. Relatively... The easiest way to keep your publications page up to date bacillus subtilisstudiesspontaneoustransformationspecificity https://tropicallegumeshub.com/rc/haplotypes-at-the-phg-2-locus-are-determining-pathotype-specificity-of-angular-leaf-spot-resistance-in-common-bean/ Haplotypes at the Phg-2 Locus Are Determining Pathotype-Specificity of Angular Leaf Spot Resistance... Sep 10, 2020 - This article reports on ALS resistance evaluations of 316 bean lines under greenhouse and field conditions at multiple sites in Colombia and Uganda. leaf spotphglocusspecificityangular https://www.commonreader.co.uk/p/accuracy-vs-specificity/comments Comments - Accuracy vs specificity. - by Henry Oliver Find the special determining quality. henry olivercommentsaccuracyvsspecificity https://researchconnect.stonybrook.edu/en/publications/engineering-the-substrate-specificity-of-the-abl-tyrosine-kinase/ Engineering the substrate specificity of the Abl tyrosine kinase - Stony Brook University stony brook universitytyrosine kinaseengineeringsubstratespecificity https://fulir.irb.hr/990/ COMBINE analysis of nuclear receptor-DNA binding specificity: Comparison of two sets of data FULIR two setscombineanalysisnuclearreceptor https://thi.ucsc.edu/event/joseph-sabbagh-specificity-and-objecthood-in-tagalog-2/ Joseph Sabbagh: "Specificity and Objecthood in Tagalog" - The Humanities Institute LINGUISTICS COLLOQUIUM Joseph Sabbagh (UT Arlington) Current analyses of the syntax of transitive constructions in Tagalog (Austronesian, Philippines) are... the humanitiesjosephspecificitytagaloginstitute https://pubblicazioni.unicam.it/handle/11581/267990 Landscape specificity landscapespecificity https://www.afronomicslaw.org/2020/05/01/multi-sided-music-platforms-and-the-law-why-platform-specificity-and-global-south-focus-matter/ Multi-sided Music Platforms and the Law: Why platform specificity and Global South focus matter |... Multi-Sided Music Platforms and the Law is a book that provides a well-informed, thorough and rigorous treatment of relevant legal issues from an African... music platformsthe lawglobal southmultispecificity https://researchprofiles.tudublin.ie/en/publications/comparative-phylogenomics-of-clostridium-difficile-reveals-clade--3/ Comparative phylogenomics of Clostridium difficile reveals clade specificity and microevolution of... clostridium difficilecomparativerevealsspecificitymicroevolution https://repositori.upf.edu/items/70ac09e9-d66c-4514-aeb8-85664c5acca0?locale=ca e-Repositori UPF :: An activity-specificity trade-off encoded in human transcription factors Transcription factors (TFs) control specificity and activity of gene transcription, but whether a relationship between these two features exists is unclear.... an activityhuman transcriptioneupffactors https://dspace.uohyd.ac.in/items/43794956-2427-49b8-9286-558b591d509b Sequence determinants for the reaction specificity of murine (12R)-lipoxygenase: Targeted substrate... Mammalian lipoxygenases (LOXs) are categorized with respect to their positional specificity of arachidonic acid oxygenation. Site-directed mutagenesis... for thesequencedeterminantsreactionspecificity