Robuta

https://repository.kallipos.gr/handle/11419/4463 Kallipos: Parathyroid glands and bone metabolism parathyroid glandsbone metabolism https://etheses.bham.ac.uk/id/eprint/14318/ UBIRA ETheses - The role of Tcf7l2 on bone metabolism role ofbone metabolism https://elifesciences.org/reviewed-preprints/95944/figures Psychological stress disturbs bone metabolism via miR-335-3p/Fos signaling in osteoclast bone metabolismpsychologicalstressviamir https://iv.iiarjournals.org/content/39/3/1492 Bone Metabolism-related Serum Biomarkers and Nutritional Markers for Bone Fractures in Living-donor... Background/Aim: The clinical importance of fracture prevention in patients with end-stage renal disease is well-established. We investigated the roles of bone... bone metabolismliving donorrelatedserumbiomarkers https://iris.univpm.it/handle/11566/325982 The Effects of Polyphenols on Bone Metabolism in Postmenopausal Women: Systematic Review and... bone metabolismsystematic revieweffectspolyphenolswomen https://pure.fujita-hu.ac.jp/en/publications/pharmacological-topics-of-bone-metabolism-recent-advances-in-phar/ Pharmacological topics of bone metabolism: Recent advances in pharmacological management of... bone metabolismrecent advancespharmacologicaltopicsmanagement https://pubmed.ncbi.nlm.nih.gov/19892499/ Effect of dietary supplementation with collagen hydrolysates on bone metabolism of postmenopausal... CH consumption did not produce any effects on bone metabolism as measured by biochemical indices of bone remodeling in postmenopausal women. The majority of... dietary supplementationbone metabolismeffectcollagen https://cris.biu.ac.il/en/publications/local-and-systemic-effects-of-radiation-on-bone-metabolism-measur/ Local and systemic effects of radiation on bone metabolism measured by quantitative SPECT -... bone metabolismlocalsystemiceffectsradiation https://acrabstracts.org/abstract/mir-146a-a-key-player-in-bone-metabolism/ MiR-146a a Key Player in Bone Metabolism - ACR Meeting Abstracts Background/Purpose: Micro RNAs (miRNAs) play a crucial role in the regulation of bone metabolism. MiR-146a, an important anti-inflammatory miRNA, was found to... player inbone metabolismmeeting abstractsmirkey https://www.siemens-healthineers.com/en-us/laboratory-diagnostics/assays-by-diseases-conditions/bone-metabolism-assays-global/bone-metabolism Bone Metabolism Assay Menu - Siemens Healthineers USA Bone Metabolism overview bone metabolismsiemens healthineersassaymenuusa https://www.journal-imab-bg.org/issues-2015/issue4/vol21issue4p901-907.html MARKERS OF BONE METABOLISM IN PATIENTS WITH CYSTIC FIBROSIS Journal of IMAB - Annual Proceeding (Scientific Papers), JofIMAB 2015 Oct-Dec;21(4):901-907 bone metabolismin patientscystic fibrosismarkers https://experts.llu.edu/en/publications/long-term-consequences-of-traumatic-brain-injury-in-bone-metaboli-3/ Long-term consequences of Traumatic brain injury in bone metabolism - Faculty Experts - Loma Linda... long term consequencestraumatic brain injurybone metabolismfaculty expertsloma linda https://www.besjournal.com/article/id/bd15072c-c12a-4324-b16a-a74c915afe6f Effect of Zinc on Bone Metabolism in Fetal Mouse Limb Culture bone metabolismeffectzincfetalmouse https://www.utupub.fi/items/2671e21d-976f-4323-9e73-e7510daa96a2 Transcription factors Ebf1 and Ebf2 in bone metabolism Bone formation and bone metabolism are controlled by several different factors and signaling pathways. Transcription factors participate in this cascade by... transcription factorsbone metabolism https://avesis.isparta.edu.tr/yayin/7567de3a-4bda-4138-8bd2-788f0781de1a/the-effect-of-simvastatin-on-serum-cytokine-levels-and-bone-metabolism-in-postmenopausal-subjects-negative-correlation-between-tnf-and-anabolic-bone-parameters The effect of simvastatin on serum cytokine levels and bone metabolism in postmenopausal subjects:... the effectbone metabolismsimvastatinserumcytokine https://brocku.scholaris.ca/items/78de27b6-0da8-4f79-9b6a-93ac19a01b1c Menstrual Cycle Related Fluctuations in Circulating Markers of Bone Metabolism at Rest and in... The aim of this study was to investigate potential fluctuations in bone metabolic markers across the menstrual cycle both at rest and after a 30-minute bout of... menstrual cyclebone metabolismat restrelatedfluctuations https://docs.google.com/document/d/1-btVrZmCCoE9_JXamLzfQ-L1-Kr9XWSadFfS6wIzdPM/pub Bone Metabolism bone metabolism https://www.mdpi.com/2077-0383/13/11/3212 Bone Metabolism and Dental Implant Insertion as a Correlation Affecting on Marginal Bone... Background/Objectives: The general condition of implantology patients is crucial when considering the long- and short-term survival of dental implants. The aim... bone metabolismdental implantinsertioncorrelationmarginal https://mjiri.iums.ac.ir/browse.php?a_id=1496&slc_lang=en&sid=1&printcase=1&hbnr=1&hmb=1 THE EFFECT OF ALUMINUM ON BIOCHEMICAL PARAMETERS RELATED TO BONE METABOLISM. A MODEL STUDY OF... The influence of aluminum on some serum parameters related to bone metabolism has been investigated by daily administration of aluminum over different periods... the effectrelated tobone metabolismaluminumbiochemical https://jbcr.arphahub.com/article/34656/list/18/ Age-Related Characteristics of Mineral and Bone Metabolism in Patients with Chronic Kidney Disease... Abnormalities in mineral and bone metabolism are a risk factor for increased cardiovascular and all-cause mortality and bone fractures in patients with chronic... chronic kidney diseasebone metabolismin patientsagerelated https://profiles.ncat.edu/en/publications/eicosapentaenoic-acid-epa-and-bone-metabolism-2/ EICOSAPENTAENOIC ACID (EPA) AND BONE METABOLISM - N.C. A&T Scholars eicosapentaenoic acidbone metabolismepascholars https://unifind.uniss.it/resource/item/139236?language=en-US Assessment of Bone Metabolism Alterations in Transfusion-dependent Beta-thalassemia Major |... Unifind is a portal where you can discover the expertise within a university by searching among experts, courses, professions, people, publications, and... bone metabolismassessmentalterationstransfusiondependent https://alfagen.com.tr/product/human-bone-metabolism-array-q1-qah-bma-1-1/ Human Bone Metabolism Array Q1 - QAH-BMA-1-1 - ALFAGEN bone metabolismhumanarraybma https://sportsnutritioncenter.com/product-tag/bone-metabolism-formula/ Bone Metabolism Formula Archives - Sports Nutrition Center LLC bone metabolismsports nutritionformulaarchivescenter https://researchconnect.buffalo.edu/en/publications/modulation-of-bone-metabolism-by-two-chemically-distinct-lipopoly/ Modulation of bone metabolism by two chemically distinct lipopolysaccharide fractions from... bone metabolismmodulationtwochemicallydistinct https://gupea.ub.gu.se/items/500b24bd-4c0d-4a0b-bf05-d1f28bd02e58 The role of the gut microbiota and frailty on bone metabolism, and the risk of injurious falls and... Aging is intrinsically linked to musculoskeletal decline, culminating in increased risk of frailty, falls, fractures, and associated morbidity and mortality.... role ofgut microbiotabone metabolismfrailtyrisk https://cme.utsouthwestern.edu/content/123-internal-medicine-grand-rounds-bariatric-surgery-and-effects-calcium-and-bone-metabolism 123 Internal Medicine Grand Rounds: "Bariatric Surgery and Effects on Calcium and Bone Metabolism"... internal medicinegrand roundsbariatric surgerybone metabolismeffects https://apcz.umk.pl/JEHS/article/view/5119 Correlative link ages between indices of bone metabolism and thyroid hormones in rats with... bone metabolismthyroid hormonesin ratsagesindices https://jmitra.co.in/products/bone-metabolism-range/ Bone Metabolism Range - JMitra & Co. Pvt. Ltd. bone metabolism rangecopvtltd https://jlupub.ub.uni-giessen.de/items/faf97a9c-ebe0-4bbb-886f-35ff2dd7542b Prevalence and effects of Vitamin D receptor polymorphism on bone mineral density and metabolism in... Patients with systemic sclerosis (SSc) have a disproportionately high prevalence of reduced bone mineral density (BMD). Polymorphisms of the vitamin D receptor... bone mineral densityprevalenceeffectsvitaminreceptor https://ricerca.unich.it/handle/11564/604713 ACHIEVEMENT OF NKF/K-DOQI RECOMMENDED TARGET VALUES FOR BONE AND MINERAL METABOLISM IN INCIDENT... bone and mineralachievementkrecommendedtarget https://doctorlib.org/physiology/ganong-review-medical-physiology/24.html Hormonal Control of Calcium and Phosphate Metabolism and the Physiology of Bone - Endocrine and... Hormonal Control of Calcium and Phosphate Metabolism and the Physiology of Bone - Endocrine and Reproductive Physiology - Ganong's Review of Medical... hormonalcontrolcalciumphosphatemetabolism https://discovery.researcher.life/search?journal=Clinical+Reviews+in+Bone+and+Mineral+Metabolism All Research Papers Published In Clinical Reviews in Bone and Mineral Metabolism | R Discovery Get access to all research papers published in Clinical Reviews in Bone and Mineral Metabolism. Stay ahead by reading recently published scholarly articles in... research papers publishedbone and mineralclinicalreviewsmetabolism https://oap-cancer.org/journal/international-journal-of-bone-and-mineral-metabolism/language-editing-service International Journal of Bone and Mineral Metabolism | IJBM | Open Access Pub | Orthopedics, Osteopathy and Bone health specialists can turn to the International Journal of Bone and Mineral Metabolism for reliable and up-to-dat... bone and mineralinternational journalopen accessmetabolismpub https://www.eatthismuch.com/calories/womens-energy-metabolism-bone-support-gummy-1975548 Vitafusion Women's Energy Metabolism & Bone Support Gummy Nutrition Facts - Eat This Much energy metabolismbone supportnutrition factseat thisvitafusion https://fluoridealert.org/studytracker/effects-of-fluoride-on-metabolism-and-mechanical-properties-of-rat-bone/ Effects of fluoride on metabolism and mechanical properties of rat bone - Fluoride Action Network mechanical propertiesaction networkeffectsfluoridemetabolism