Contact DMCA Privacy

Robuta

https://elifesciences.org/articles/87086v1
Systematic analysis of the molecular and biophysical properties of key DNA damage response factors...
systematicanalysismolecularbiophysicalproperties
https://pubmed.ncbi.nlm.nih.gov/17086449/
Response of arsenic-induced oxidative stress, DNA damage, and metal imbalance to combined...
Arsenic and its compounds cause adverse health effects in humans. Current treatment employs administration of thiol chelators, such as...
oxidative stressdna damageresponsearsenicinduced
https://pubmed.ncbi.nlm.nih.gov/19818714/
BBAP monoubiquitylates histone H4 at lysine 91 and selectively modulates the DNA damage response
Although the BBAP E3 ligase and its binding partner BAL are overexpressed in chemotherapy-resistant lymphomas, the role of these proteins in DNA damage...
bbaphistonelysine
https://pubmed.ncbi.nlm.nih.gov/41605654/
A systems view on DNA damage response kinetics in Tetrahymena
A tightly regulated DNA damage response is critical to the overall integrity of the genome. Here, we combine transcriptomics and proteomics to study DNA damage...
dna damage responsesystemsviewkineticstetrahymena
https://pubmed.ncbi.nlm.nih.gov/39063148/
Tau beyond Tangles: DNA Damage Response and Cytoskeletal Protein Crosstalk on Neurodegeneration
Neurons in the brain are continuously exposed to various sources of DNA damage. Although the mechanisms of DNA damage repair in mitotic cells have been...
dna damage responsecytoskeletal proteintaubeyondtangles
https://www.frontiersin.org/journals/physiology/articles/10.3389/fphys.2022.968927/full
Frontiers | The regulatory roles of the E3 ubiquitin ligase NEDD4 family in DNA damage response
E3 ubiquitin ligases, an important part of ubiquitin proteasome system, catalyze the covalent binding of ubiquitin to target substrates, which plays a role i...
ubiquitin ligasefrontiersregulatoryroles
https://www.nist.gov/publications/bisphenol-leads-oxidative-dna-damage-and-alters-damage-response-mouse-fibroblasts
Bisphenol A leads to oxidative DNA damage and alters the damage response in mouse fibroblasts | NIST
Metabolism of bisphenol A (BPA) generates reactive oxygen species causing DNA strand breaks and damaged DNA bases.
oxidative dna damageleads tobisphenolalters