https://air.unipr.it/handle/11381/2961153
Divergence of chemosensing during the early stages of speciation
early stagesdivergencespeciation
https://ppp.worldbank.org/library/guidelines-early-stages-development-ppps-health-sector-philippines-draft-consultation
Guidelines for early stages of development of PPPs in health sector - Philippines (draft for...
Find it @ PPPLRC : public-private partnership and infrastructure documents and reference materials
stages of developmentin healthguidelinesearlyppps
https://jeopardylabs.com/print/history-of-rock-n-roll-early-stages
History of Rock N' Roll-Early Stages
1870-1900 what was going on in america during this time?, 1900-1930 what was beginning to happen in music?Hint: Blues/jazz or rock n roll? , 1940-1950 What...
rock n rollearly stageshistory
https://www.valueinvestingworld.com/2013/05/loeb-says-japan-rally-in-early-stages.html
Value Investing World: Loeb Says Japan Rally in Early Stages
Thanks to Will for passing this along. Add hedge-fund manager Daniel Loeb to the list of big-name investors making bullish bets on Jap...
value investingearly stagesworldsaysjapan
https://c-brats.com/media/categories/early-stages-of-camperback.18310/
early stages of camperback | The C-Brats
early stagesthe cbrats
https://repository.si.edu/items/1faf1c5c-e4a0-4cac-add2-ffeb4f50e7a3
Descriptions of Early Stages of Caligo Illioneus Oberon Butler, and C. Idomeneus (L.) From the...
early stagesfrom thedescriptionsoberonbutler
https://cordis.europa.eu/project/id/258868/reporting/it
A Nanoscale Artificial Nose to easily detect Volatile Biomarkers at Early stages of Lung Cancer and...
Latest report summary
early stageslung cancerartificialnoseeasily
https://mider.openrepository.com/entities/publication/51aacd63-ac7e-4a52-a1b3-e75dd812eb26
The effects of rivastigmine on neuropsychiatric symptoms in the early stages of Parkinson's disease...
Aims Neuropsychiatric symptoms including depression, apathy and psychosis are experienced by the majority of patients with Parkinson's disease. A subgroup of...
early stageseffectsrivastigminesymptomsparkinson
https://www.straitstimes.com/opinion/trump-tariff-pause-we-may-be-in-the-early-stages-of-a-world-minus-one
Trump tariff pause: We may be in the early stages of a World Minus One | The Straits Times
Apr 11, 2025 - The start-stop approach to tariffs will accelerate diversification of trade away from the US and more. Read more at straitstimes.com.
trump tariffmay beearly stagesstraits timespause
https://www.agenciachange.com/post/kickstart-your-change-management-assignment-strategies-for-productivity-in-the-early-stages
Kickstart Your Change Management Assignment: Strategies for Productivity in the Early Stages
May 6, 2026 - Discover strategies for early productivity in change management. Learn essential steps for early productivity in your next assignment, building your change...
change management assignmentfor productivityearly stageskickstartstrategies
https://globalhealthnewswire.com/diseases/2022/01/24/smoke-exposure-in-the-early-stages-of-life-alters-sleep-patterns-in-adults
Smoke Exposure in the Early Stages of Life Alters Sleep Patterns in Adults - Global Health News Wire
Jan 24, 2022 - Researchers of the University of Bologna carried out a study on murine models (mice) demonstrating that pre-natal exposure to nicotine and its by-products...
stages of lifeglobal health newssmoke exposureearlyalters
https://www.qradio.com/archive/im-excited-to-get-into-it-alicia-keys-is-in-the-early-stages-of-her-next-album/
'I'm excited to get into it': Alicia Keys is in the early stages of her next album - Q Radio
Big Personality, Big Reach
get into italicia keysearly stagesnext albumq radio
https://moneyandmarkets.com/kudlow-trump-economic-boom-early-stages/
Larry Kudlow: Trump's Economic Boom In Early Stages
Jan 6, 2020 - Larry Kudlow declared that the economic boom we are seeing under President Donald Trump is merely in its "early innings."
larry kudlowearly stagestrumpeconomicboom
https://fis.uni-bamberg.de/entities/publication/634c9e4c-3f21-4ec4-8f88-aaa1d4d7ef37
Pavlovian and instrumental conditioning in the early stages of gaming disorder and buying-shopping...
early stagesgaming disorderinstrumentalconditioningbuying
https://www.iris.unicz.it/handle/20.500.12317/676
A Selective Egocentric Topographical Working Memory Deficit in the Early Stages of Alzheimer's...
working memoryearly stagesselectiveegocentrictopographical
https://research.wu.ac.at/de/publications/changes-in-social-norms-during-the-early-stages-of-the-covid-19-p/
Changes in social norms during the early stages of the COVID-19 pandemic across 43 countries - WU...
social normsearly stageschangescovidpandemic
https://www.sintef.no/en/publications/publication/939090/
User Friendly Framework for Measuring Product and Process Novelty in the Early Stages of Product...
user friendlyearly stagesframeworkmeasuringproduct
https://profiles.ncat.edu/en/publications/impacts-of-covid-19-on-the-transport-sector-in-china-facts-and-in-2/
Impacts of COVID-19 on the transport sector in China: Facts and insights from early stages - N.C....
on thetransport sectorin chinaearly stagesimpacts
https://www.biotechnews.com.au/agoda-reports-localization-in-early-stages-lifts-guest-spend-for-92-of-thailand-hotels/
Agoda Reports Localization in Early Stages Lifts Guest Spend for 92% of Thailand Hotels -...
Feb 4, 2026 - Insights from Agoda reveal how integrated, tailored guest experiences and digital partnerships are helping Thai hotels stand out amid rising regional travel...
early stagesthailand hotelsagodareportslocalization
https://www.urbanvelo.org/3-rules-to-the-early-stages-away-from/
3 Rules to the Early stages away from Relationships | Urban Velo
3 Rules to the Early stages away from Relationships Today We step regarding all of our usual style and you may beauty ramblings and you may..
to theearly stagesrulesawayrelationships
https://www.preprints.org/manuscript/201906.0194/v1
Ectopic Lipid Accumulation is Key Feature in Early Stages of Wooden Breast[v1] | Preprints.org
Wooden breast is a muscle disorder affecting modern commercial broiler chickens that causes a palpably firm pectoralis major muscle and severe reduction in...
key featureearly stageslipidaccumulationwooden
https://theses.gla.ac.uk/76815/
Community and Discipline: Some Early Stages of Community Discipline in the Old Testament: The...
the old testamentearly stagescommunitydiscipline
https://riskandinsurance.com/most-insurers-expect-ai-to-transform-their-business-but-remain-in-early-stages-of-adoption/
Most Insurers Expect AI to Transform Their Business but Remain in Early Stages of Adoption - Risk &...
early stagesinsurersexpectaitransform
https://pure.skku.edu/en/publications/in-situ-observation-of-the-early-stages-of-rapid-solid-liquid-rea/fingerprints/?sortBy=alphabetically
In Situ Observation of the Early Stages of Rapid Solid-Liquid Reaction in Closed Liquid Cell TEM...
in situearly stagesobservationrapidsolid
https://publica.fraunhofer.de/entities/publication/607f1209-426e-42e7-a76d-d0442fab353d
In situ natural ageing of Al-Cu-(Mg) alloys: The effect of In and Sn on the very early stages of...
The influence of trace elements (0.01 at.% In/Sn) on the decomposition process of Al-Cu-(Mg) alloys during the very early stages of natural ageing has been...
in situthe effectearly stagesnaturalageing
https://unipv.unifind.cineca.it/resource/item/25263?language=en-US
UNIFIND - UNIPV -Memantine as a neuroprotective agent in early stages of psychosis
Unifind is a portal where you can discover the expertise within a university by searching among experts, courses, professions, people, publications, and...
as aagent inearly stagesmemantineneuroprotective
https://research.uni-luebeck.de/en/publications/fr%C3%BChformen-rheumatischer-erkrankungen/
Early stages of rheumatic diseases - University of Luebeck
early stagesdiseasesuniversityluebeck
https://nrc-publications.canada.ca/fra/voir/objet/?id=2c111b5e-0193-4aa2-a190-909553a07c3f
Morphological descriptions of the early stages of spine and vertebral development in...
Morphological descriptions of the early stages of spine and vertebral development in hatchery-reared larval and juvenile Atlantic halibut (Hippoglossus...
early stagesdescriptionsspinedevelopment
https://aidsreviews.com/en/2004/early-stages-of-hiv-replication-how-to-hijack-cellular-functions-for-a-successful-infection/
Early Stages of HIV Replication: How to Hijack Cellular Functions for a Successful Infection - Aids...
early stageshiv replicationhow tocellular functionshijack
https://www.startupfino.com/blogs/ca-services-for-startups-in-early-stages/
CA Services for Startups in Early-Stages
Apr 23, 2024 - CA services for startups bring experience and also know the way to be trusted advisors and coaches to startups in their early years.
services for startupsearly stagesca
https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0264511
Relationship satisfaction in the early stages of the COVID-19 pandemic: A cross-national...
The outbreak of the COVID-19 pandemic has had a large impact on various aspects of life, but questions about its effects on close relationships remain largely...
relationship satisfactionearly stagescovidpandemiccross
https://pure.psu.edu/en/publications/metrics-for-assessing-design-freedom-and-information-certainty-in/
Metrics for assessing design freedom and information certainty in the early stages of design - Penn...
design freedomearly stagesmetricsassessinginformation
https://www.nowtheendbegins.com/hedge-fund-giant-ray-dalio-warns-we-are-already-entering-the-early-stages-of-a-global-conflict-that-could-soon-become-a-full-blown-world-war/
Hedge Fund Giant Ray Dalio Warns We Are Already Entering The Early Stages Of A Global Conflict That...
Apr 12, 2026 - Author Ray Dalio Issues A Chilling Warning That The Current Chaos Around The Globe Is Part Of A Larger Struggle That May Soon Erupt Into World War Bridgewater...
hedge fundray daliowe areearly stagesglobal conflict
https://www.lcmchealth.org/west-jefferson-medical-center/blog/2020/october/3-steps-to-detecting-breast-cancer-in-the-early-/
3 steps to detecti breast cancer in the early stages
As with all cancers, you have a better chance of survival if detected early. Oncologist, Dr. Nelly Aoun, says when it comes to breast cancer, there are certain...
breast cancerearly stagessteps
https://itrussia.media/en/article/drones-with-smart-cameras-detect-power-line-fault-24-04-2026
Drones With Smart Cameras Detect Power Line Faults at Early Stages | IT Russia
Apr 24, 2026 - The technology can identify defects long before they become visible to the human eye. | IT Russia
smart cameraspower lineearly stagesdronesdetect
https://www.news-medical.net/news/20210511/Fast-lifestyle-changes-during-early-stages-of-pandemic-had-little-effect-on-climate-change.aspx
Fast lifestyle changes during early stages of pandemic had little effect on climate change
May 11, 2021 - Despite the rapid and significant changes in consumption patterns witnessed during the initial months of the COVID-19 pandemic, Japanese households maintained...
on climate changelifestyle changesearly stagesfastpandemic
https://c-path.org/the-qualification-of-an-enrichment-biomarker-for-clinical-trials-targeting-early-stages-of-parkinsons-disease-2/
The Qualification of an Enrichment Biomarker for Clinical Trials Targeting Early Stages of...
for clinical trialsearly stagesqualificationenrichmentbiomarker
https://www.standardmedia.co.ke/evewoman/index.php/relationships/article/2001544823/building-romance-in-the-early-stages-of-dating
Building romance in the early stages of dating - The Standard Evewoman Magazine
Some of the common mistakes that people make during the early stages of dating include love-bombing, trying to influence the other person using money and gifts...
early stagesbuildingromancedatingstandard
https://www.ausgamers.com/news/read/3634749/respawn-is-in-the-early-stages-of-creating-a-brand-new-ip
Respawn is in the Early Stages of Creating a Brand-New IP - AusGamers.com
Which would be a new game from Respawn, the talented studio behind Apex Legends, Titanfall, and Star Wars Jedi: Fallen Order -- and one not connected to any of...
early stagesbrand newrespawncreatingip
https://theenterpriseworld.com/6-challenges-dropshipping-startups/
6 Challenges Dropshipping Startups May Face in Early Stages | The Enterprise World
Apr 22, 2025 - The popularity of e-commerce witnessed a surge amid the pandemic, with most retailers adopting this business model during lockdowns. Dropshipping startups...
the enterprise worldearly stageschallengesdropshippingstartups
https://cris.haifa.ac.il/en/publications/poverty-and-income-inequality-in-the-early-stages-of-the-great-re/
Poverty and income inequality in the early stages of the great recession - University of Haifa
income inequalityearly stagesgreat recessionpovertyuniversity
https://edurev.in/question/4305476/What-was-the-initial-objective-of-the-French-6th-Army-during-the-early-stages-of-World-War-I-a-To-de
What was the initial objective of the French 6th Army during the early stages of World War I?a)To...
May 07,2026 - What was the initial objective of the French 6th Army during the early stages of World War I?a)To defend Parisb)To attack German fortifications...
world war iearly stagesinitialobjectivefrench
https://acp.copernicus.org/articles/12/11003/2012/
ACP - Thunderstorms and upper troposphere chemistry during the early stages of the 2006 North...
early stagesacpthunderstormsuppertroposphere
https://wfamilymedicine.com/health-news/dementia-symptoms-a-sign-in-the-eyes-proven-to-identify-early-stages-of-condition/
Dementia symptoms: A sign in the eyes proven to identify early stages of condition - Worlds Family...
Apr 8, 2019 - Identifying reduced blood capillaries in the retina may be a
a signthe eyesearly stagesdementiasymptoms
https://pure.ewha.ac.kr/en/publications/proteomic-analysis-of-liver-tissue-from-hbx-transgenic-mice-at-ea/
Proteomic analysis of liver tissue from HBx-transgenic mice at early stages of hepatocarcinogenesis...
proteomic analysisearly stageslivertissuehbx
https://www.nhbs.com/hominid-evolution-the-early-stages
Hominid Evolution: The Early Stages | NHBS Academic & Professional Books
Buy Hominid Evolution: The Early Stages: NHBS - Anne Zeller, Insight Media Inc
early stagesprofessional bookshominidevolutionnhbs
https://www.shtfplan.com/headline-news/we-are-witnessing-an-enormous-wave-of-bankruptcies-and-layoffs-during-the-early-stages-of-2023
We Are Witnessing An Enormous Wave Of Bankruptcies And Layoffs During The Early Stages Of 2023 |...
Jan 20, 2023 - Is your job safe? Right now, we are witnessing so much turmoil in so many different sectors of our economy. The housing market is crashing, the cryptocurrency...
we areearly stageswitnessingenormouswave
https://newstartrecovery.com/rehab-blog/dealing-with-changes-in-early-recovery/
Dealing with Changes in the Early Stages of Recovery
Oct 1, 2025 - Early recovery can bring so many new challenges. Dealing with changes is hard and confusing but here are some tips to overcome those obstacles in recovery.
stages of recoverydealingchangesearly
https://www.globalvillagespace.com/tag/early-stages/
early stages Archives - Global Village Space
early stagesglobal villagearchivesspace
https://www.rug.nl/about-ug/latest-news/events/promoties/?hfId=123401
Tracking CHNOS during the early stages of planet formation with a model-laboratory approach |...
early stagesplanet formationtrackingmodellaboratory
https://decrypt.co/156626/no-bubble-here-goldman-sachs-says-ai-still-in-early-stages
No Bubble Here: Goldman Sachs Says AI Still in Early Stages - Decrypt
Sep 29, 2023 - Goldman Sachs foresees a promising future for AI investments, debunking bubble theories and projecting a bullish market.
goldman sachsearly stagesbubblesaysai
https://www.mediapost.com/publications/article/166457/mobile-video-primed-ad-model-in-early-stages.html?edition=42629
Mobile Video Primed, Ad Model In Early Stages 01/25/2012
Mobile Video Primed, Ad Model In Early Stages - 01/25/2012
mobile videoearly stagesprimedadmodel
https://www.ejgo.net/articles/10.12892/ejgo200206501
Does FIGO clinical stage influence the survival of patients with early stages of uterine cervix...
European Journal of Gynaecological Oncology (EJGO) is an international, peer-reviewed, open access journal, which is currently indexed in SCIE, etc. It covers...
early stagesfigoclinicalinfluencesurvival
https://menafn.com/1109429040/Mantra-CEO-Prioritizes-OM-Token-Recovery-In-Early-Stages-A-Primary-Concern
Mantra CEO Prioritizes OM Token Recovery In Early Stages: A Primary Concern
Mantra CEO Prioritizes OM Token Recovery In Early Stages: A Primary Concern. The early stages of Mantra DAO's buybacks are prominent. This strategic move is...
early stagesmantraceoomtoken
https://epjst.epj.org/articles/epjst/abs/2023/13/11734_2023_Article_905/11734_2023_Article_905.html
Current status of deMon2k for the investigation of the early stages of matter irradiation by...
The European Physical Journal Special Topics (EPJ-Special Topics) is devoted to the rapid and timely publication of topical issues in all fields pertaining to...
current statusfor theearly stagesinvestigationmatter
https://www.socionauki.ru/journal/articles/875359/
The Early Stages of Globalization Evolution: Networks of Diffu-sion and Exchange of Domesticates,...
early stagesglobalizationevolutionnetworkssion
https://pubmed.ncbi.nlm.nih.gov/24148570/?dopt=Abstract
Positively correlated miRNA-mRNA regulatory networks in mouse frontal cortex during early stages of...
This study provides new evidence for the role of miRNA regulation in brain homeostasis and sheds new light on current understanding of the development of...
regulatory networksearly stagespositivelycorrelatedmirna
https://www.spacewar.com/reports/Researchers_capture_first_atomic_scale_images_depicting_early_stages_of_particle_accelerator_film_formation_999.html
Researchers capture first atomic-scale images depicting early stages of particle accelerator film...
Chicago IL (SPX) Apr 26, 2023 - Researchers from Prof. Steve Sibener's group have captured the first atomic-scale images of tin on niobium during the growth...
atomic scaleearly stagesparticle acceleratorresearcherscapture
https://research.monash.edu/en/publications/mechanistic-insight-into-the-early-stages-of-amyloid-formation-us/
Mechanistic insight into the early stages of amyloid formation using an anuran peptide - Monash...
early stagesmechanisticinsightamyloidformation
https://publires.unicatt.it/it/publications/auxin-effects-on-maize-seed-transciptome-during-the-early-stages--9/
Auxin effects on maize seed transciptome during the early stages of endosperm development -...
early stageseffectsmaizeseeddevelopment
https://www.tewused.com/product-page/themes-for-a-day-early-stages-blm-s-year-1
Themes for a Day Early Stages BLM's Year 1 | TEW USED
In very Good Condition
a dayearly stagesthemesblmyear
https://scholar.xjtlu.edu.cn/en/publications/early-stages-of-biofilm-succession-in-a-lentic-freshwater-environ/
Early stages of biofilm succession in a lentic freshwater environment - Xi'an Jiaotong-Liverpool...
early stagesfreshwater environmentxi anbiofilmsuccession
https://academiccommons.columbia.edu/doi/10.7916/720k-4k77
Understanding the molecular, cellular, and circuit defects characterizing the early stages of...
One of the most foundational and personal philosophical questions one can ask is what makes you, you? In large part, you are made up of your relationships,...
understanding theearly stagesmolecularcellularcircuit
https://www.ispor.org/vih-articles/Volume-26--Supplemental-Issue-12S/EE225-Exploring-the-Value-of-Country-Specific-Cost-Effectiveness-Models-in-Early-Stages-of-Drug-Development
EE225 Exploring the Value of Country-Specific Cost-Effectiveness Models in Early Stages of Drug...
the valuecountry specificcost effectivenessearly stagesexploring
https://www.migrationresearch.com/item/using-twitter-to-track-immigration-sentiment-during-early-stages-of-the-covid-19-pandemic/747019
Using Twitter to Track Immigration Sentiment During Early Stages of the COVID-19 Pandemic
early stagesusingtwittertrackimmigration
https://gracebook.app/blogs/96616/How-to-know-urology-cancer-symptoms-in-India-at-early
How to know urology cancer symptoms in India at early stages?
When you see blood in your urine, even once it can fill you with fear. We know how painful that moment feels. At our hospital, we take such signs very...
how tourology cancerearly stagesknowsymptoms
https://edoc.ub.uni-muenchen.de/35897/
Chemical segregation in the early stages of star formation
early stagesstar formationchemicalsegregation
https://www.ndtvprofit.com/world/ray-dalio-warns-us-iran-conflict-may-be-part-of-early-stages-of-a-world-war-11376100
Ray Dalio Warns US-Iran Conflict May Be Part Of 'Early Stages Of World War'
Ray Dalio said that what is happening today is not a single war but a series of connected global conflicts that resemble past world wars.
ray dalioiran conflictmay bepart ofearly stages
https://newsmint24.com/due-to-the-covid-testing-we-were-able-to-catch-a-lot-of-lung-cancer-cases-in-its-early-stages/
Due to the COVID testing we were able to catch a lot of Lung cancer cases in its early stages -...
Aug 30, 2022 - Cancer is considered as the second most common cause of death worldwide, leading to 1out of every 6 deaths. As per reports from the International Agency for...
to thecovid testinga lotlung cancerearly stages
https://www.ornamo.fi/en/press-release/press-release-uncertainty-in-the-working-life-is-now-affecting-designers-in-the-early-stages-of-their-careers-says-survey/
Press release: Uncertainty in the working life is now affecting designers in the early stages of...
Jun 23, 2025 - The diversity of the design sector is evident in the salaries, future expectations and even job satisfaction of professionals. The general economic uncertainty...
life is nowpress releaseearly stagesuncertaintyworking
https://www.traveladventures.org/continents/asia/manaslu-circuit-first-week06.html
Snowy mountains visible through the clouds in the early stages of the Manaslu Circuit, Manaslu...
Snowy mountains visible through the clouds in the early stages of the Manaslu Circuit from Manaslu Circuit first week, Nepal. Travel story and photos by...
snowy mountainsthe cloudsearly stagesmanaslu circuitvisible
https://kazanmedjournal.ru/kazanmedj/article/view/6230
First experience of lymphoscintigraphy use in early stages of breast cancer - Vatankha - Kazan...
First experience of lymphoscintigraphy use in early stages of breast cancer
early stagesbreast cancerfirstexperienceuse
https://www.mis.mpg.de/publications/preprint-repository/article/2011/issue-3
Chinese characters reveal impacts of prior experience on very early stages of perception MiS...
Delve into the future of research at MiS with our preprint repository. Our scientists are making groundbreaking discoveries and sharing their latest findings...
chinese charactersearly stagesrevealimpactsprior
https://www.slashgear.com/zune-to-ipod-cable-in-very-early-stages-of-gestation-024162/
Zune To iPod Cable In Very Early Stages Of Gestation
Feb 14, 2019 - A common complaint levelled at Microsoft's Zune is the relative scarcity of aftermarket accessories like speaker-docks and charging cables compared to the...
early stageszuneipodcablegestation
https://www.hngn.com/articles/89302/20150502/kate-middleton-royal-baby-duchess-cambridge-admitted-lindo-wing-early.htm
Kate Middleton and Royal Baby: Duchess of Cambridge Admitted to Lindo Wing, in 'Early Stages of...
May 2, 2015 - The Duchess of Cambridge has been admitted to the hospital for the birth of her second child. Kensington Palace has confirmed that Kate Middleton was admitted...
duchess of cambridgekate middletonroyal babyearly stagesadmitted
https://scholar.lib.ntnu.edu.tw/zh/publications/the-early-stages-and-biology-of-minois-nagasawae-matsumura-lepido-2/
The early stages and biology of Minois nagasawae (Matsumura) (Lepidoptera: Nymphalidae, Satyrinae),...
early stagesbiologyminoislepidopteranymphalidae
https://www.designsociety.org/publication/43068/opportunities_with_uncertainties_the_outlook_of_virtual_reality_in_the_early_stages_of_design
OPPORTUNITIES WITH UNCERTAINTIES: THE OUTLOOK OF VIRTUAL REALITY IN THE EARLY STAGES OF DESIGN /...
Hu, Xinhui; Georgiev, Georgi. V.
virtual realityearly stagesopportunitiesuncertaintiesoutlook
https://www.agriland.co.uk/farming-news/winter-milk-controlling-scc-in-the-early-stages-of-lactation/
Winter milk: Controlling SCC in the early stages of lactation - Agriland.co.uk
Nov 27, 2024 - Controlling SCC is not always easy during early lactation of your winter milking herds, particularly when you are milking cows off cubicles.
early stageswintermilkcontrollingscc
https://thethundergh.com/covid-19-uk-in-early-stages-of-third-wave/
Covid-19: UK in early stages of third wave - The Thunder Gh
Jun 1, 2021 - There are signs the UK is in the early stages of a third wave of coronavirus infections, a scientist advising the government has said. Prof Ravi Gupta, from
early stagesthird wavecovidukthunder
https://scholars.mssm.edu/en/publications/therapeutic-interventions-into-early-stages-of-follicle-maturatio-2/
Therapeutic interventions into early stages of follicle maturation: A new treatment paradigm after...
therapeutic interventionsearly stagesfolliclematurationnew
https://perfilesycapacidades.javeriana.edu.co/es/projects/predicting-early-stages-of-burnout-a-longitudinal-study-of-the-re-4/
Predicting Early Stages of Burnout: A longitudinal study of the relationships between workplace...
early stageslongitudinal studyburnoutrelationshipsworkplace
https://experts.umn.edu/en/publications/word-study-for-vocabulary-development-in-the-early-stages-of-lite/
Word study for vocabulary development in the early stages of literacy learning: Ecological...
word studyvocabulary developmentearly stagesliteracy learningecological
https://www.powerinfotoday.com/nuclear-energy/duke-energy-enters-early-stages-of-nuclear-development/
Duke Energy Enters Early Stages of Nuclear Development
Jan 7, 2026 - Duke Energy is going ahead with the early stages of nuclear development in North Carolina through submission of an early site permit - ESP application.
duke energyearly stagesnucleardevelopment
https://www.saturdaydownsouth.com/news/college-football/auburns-war-eagle-vii-could-be-in-early-stages-of-heart-failure/
Auburn's War Eagle VII could be in early stages of heart failure - Saturday Down South
Nov 6, 2019 - Nova has been at Auburn since 2000.
saturday down southwar eaglebe inearly stagesheart failure
https://portal.fis.tum.de/en/publications/mir-124-coordinates-metabolic-regulators-acting-at-early-stages-o/
miR-124 coordinates metabolic regulators acting at early stages of human neurogenesis - Technical...
metabolic regulatorsearly stagesmircoordinatesacting
https://www.derm.city/post/ai-system-identifies-melanoma-in-early-stages
AI system identifies melanoma in early stages
Feb 26, 2024 - Artificial intelligence (AI) could help in the early detection of skin cancers, according to a study from Dalhousie University in Halifax. That is particularly...
ai systemearly stagesmelanoma
https://www.programmaster.org/PM/PM.nsf/ApprovedAbstracts/7274091A00B1F0B2852586EE006EFE61?OpenDocument
Early Stages of Liquid-metal Embrittlement in an Advanced High-strength Steel
early stageshigh strengthliquidmetalembrittlement
https://www.chainalysis.com/blog/terrorism-financing-cryptocurrency-2019/
Terrorism Financing in Early Stages with Cryptocurrency But Advancing Quickly - Chainalysis
Apr 9, 2026 - Cryptocurrency as a terrorism financing tool presents difficult issues for the intelligence community. We compare case studies of two such campaigns.
terrorism financingearly stagescryptocurrencyadvancingquickly
https://www.statista.com/chart/9604/5g-subscription-forecast/
Chart: 5G Is Still in the Early Stages of Its Lifecycle | Statista
This chart shows a forecast of 5G subscriptions worldwide.
early stageschartstilllifecyclestatista
https://www.balitangmarino.com/post/7-symptoms-of-the-early-stages-of-hiv
7 Symptoms of the early stages of HIV
Sep 25, 2025 - Symptoms of HIV can vary between individuals however the first signs of infection generally appear within the first 1-2 months. Many, but not all, people will...
early stagessymptomshiv
https://research.uniupo.it/en/publications/effects-of-the-human-cd38-glycoprotein-on-the-early-stages-of-the/
Effects of the human cd38 glycoprotein on the early stages of the HIV-1 replication cycle -...
the humanearly stageseffectsglycoproteinhiv
https://www.3blmedia.com/news/sri-latin-america-early-stages
SRI in Latin America: Early Stages
latin americaearly stagessri