https://www.hirekit.co/salary-guide/firmware-engineer/san-francisco
Firmware Engineer Salary in San Francisco, CA (2026) | HireKit | HireKit
Discover Firmware Engineer salaries in San Francisco, CA. Entry-level: $177,650-$252,450. Senior: $327,250-$392,700.
in san franciscofirmware engineersalaryca
https://jobs.anitab.org/companies/apple/jobs/76664975-wireless-rf-phy-firmware-engineer
Wireless RF PHY Firmware Engineer @ Apple | AnitaB.org Job Board
Join the AnitaB.org Job Board and Talent Network to search for jobs, explore companies, and upload your resume to find opportunities tailored just for you!
wireless rffirmware engineerphyapplejob
https://angelandgenie.com/job-category/embedded-firmware-engineer/
Embedded Firmware Engineer - Angel and Genie - Top Executive Search Firm - Leading Recruitment...
embedded firmware engineer
https://alpha-ict.in/firmware-engineer-embedded-c/
Firmware Engineer (Embedded C) - Alpha ICT
Apr 14, 2026 - we are looking for Embedded Firmware Developer with Embedded C expertise.
firmware engineerembeddedcalpha
https://www.assaabloy.com/career/en/open-positions/job.46717
Embedded Firmware Engineer | ASSA ABLOY
embedded firmware engineerassaabloy
https://www.globallogic.com/in/careers/middle-embedded-firmware-engineer-irc292145/
Middle Embedded Firmware Engineer IRC292145 | GlobalLogic India
Apr 9, 2026 - Middle Embedded Firmware Engineer IRC292145 at GlobalLogic India - Be part of our dynamic team and drive innovation and growth. Apply now and take your caree...
embedded firmware engineermiddlegloballogicindia
https://www.xing.com/profile/AJAIY_RAMASUBRAMANIAN
AJAIY RAMASUBRAMANIAN - Firmware Engineer - Ather Energy | XING
AJAIY RAMASUBRAMANIAN, Bangalore Professional experience, contact details, portfolio, etc.: Find out more or get in touch with AJAIY RAMASUBRAMANIAN on XING.
firmware engineerather energyxing
https://jobs.anitab.org/companies/apple/jobs/56085271-5g-4g-cellular-layer1-control-firmware-engineer
5G/4G Cellular Layer1 Control Firmware Engineer @ Apple | AnitaB.org Job Board
Join the AnitaB.org Job Board and Talent Network to search for jobs, explore companies, and upload your resume to find opportunities tailored just for you!
firmware engineer
https://www.leonlegion.com/senior-robotics-firmware-engineer
Senior Robotics & Firmware Engineer | LeonLegion
We are seeking a highly motivated and talented Robotics Scientist/Engineer with a strong theoretical foundation in core robotics concepts to join our dynamic...
firmware engineerseniorrobotics
https://leva-eu.com/job/embedded-junior-firmware-engineer-bachelor-master-cleantron-amsterdam-nl/
Embedded Junior Firmware Engineer Bachelor/Master, Cleantron - Amsterdam (NL) - LEVA-EU
Mar 14, 2024 - Source About the job Embedded Junior Firmware Engineer Bachelor/Master Are you interested in working for an innovative and growing business? Are you interested...
firmware engineerembeddedjuniorbachelor
https://eu-recruit.com/jobs/senior-security-firmware-engineer/
Senior Security Firmware Engineer - European Tech Recruit
Join the team as a Senior Security Firmware Engineer. Build trusted environments and protect AI platforms with advanced firmware. Apply today!
senior securityfirmware engineereuropeantechrecruit
https://aegis-search.com/jobs/4570-engineering-firmware-engineer-2-arlington-virginia/
Firmware engineer Job | Aegis Search
Nov 26, 2025 - We are looking for a firmware engineer to join once of Washington D.Cs most exciting and fastest growing businesses! You will be working on mission critical ...
firmware engineerjobaegissearch
https://job-boards.greenhouse.io/nerostechnologies/jobs/5095368007
Job Application for Firmware Engineer - Tennessee Office at Neros Technologies
Tennessee, United States
job applicationfirmware engineertennesseeofficeneros
https://jobs.anitab.org/companies/apple/jobs/62519753-wireless-rf-phy-firmware-engineer
Wireless RF PHY Firmware Engineer @ Apple | AnitaB.org Job Board
Join the AnitaB.org Job Board and Talent Network to search for jobs, explore companies, and upload your resume to find opportunities tailored just for you!
wireless rffirmware engineerphyapplejob
https://jobs.discovertechnata.com/companies/sanmina-corporation-2/jobs/51452901-firmware-engineer
Firmware Engineer @ Sanmina Corporation | Discover Technata Job Board
Search job openings across the Discover Technata network.
firmware engineercorporationdiscoverjobboard
https://career.electroluxgroup.com/global/en/job/EISAGLOBALJR73948EXTERNALENGLOBAL/Senior-Electronic-Firmware-Engineer
Senior Electronic Firmware Engineer in Rayong, Thailand | Tech at Electrolux Group
Apply for Senior Electronic Firmware Engineer job with AB Electrolux in Rayong, Thailand. Tech at AB Electrolux
firmware engineerseniorelectronic
https://www.platform-recruitment.com/job/firmware-engineer-5
Job - Firmware Engineer | Platform Recruitment
firmware engineerjobplatformrecruitment
https://careers.hyperplane.vc/companies/pickle-robot/jobs/74423518-senior-firmware-engineer
Senior Firmware Engineer @ Pickle Robot | Hyperplane Venture Capital Job Board
Search job openings across the Hyperplane Venture Capital network.
senior firmware engineerventure capitalpicklerobotjob
https://jobs.primary.vc/companies/etched/jobs/61382294-senior-firmware-engineer-taiwan
Senior Firmware Engineer (Taiwan) @ Etched | Primary Venture Partners Job Board
Search job openings across the Primary Venture Partners network.
senior firmware engineerventure partnerstaiwanetchedprimary
https://talentgiants.com/jobs/title/firmware-engineer
Firmware Engineer Jobs at hyper-growth companies | Talent Giants
Browse 0 Firmware Engineer jobs at the world's fastest-growing AI, Data and Technology hyper-growth companies. Updated daily.
firmware engineerhyper growthjobscompaniestalent
https://careers.qualcomm.com/careers/job/446718356175-firmware-engineer-software-engineer-arduino-turin-italy-turin-torino-italy?domain=qualcomm.com
Firmware Engineer/Software Engineer - Arduino, Turin, Italy | Qualcomm
Bachelor's degree in Engineering, Information Systems, Computer Science, or related field and 4+ years of Software Engineering or related work experience. OR...
firmware engineersoftwarearduinoturinitaly
https://www.livecareer.com/resume-examples/firmware-engineer
4 Firmware Engineer Resume Examples, Templates, & Tips for 2026
Jan 18, 2026 - Explore our professional firmware engineer resume examples and templates, and find expert tips on how to write an interview-winning resume.
firmware engineer resumeexamplestemplatestips
https://assaabloy.jobs2web.com/job/Berlin-Firmware-Engineer-II-CT-06037/1254648901/
Firmware Engineer II Job Details | ASSA ABLOY
Berlin Firmware Engineer II - CT, 06037
firmware engineerjob detailsiiassaabloy
https://jobs.blackbird.vc/companies/morse-micro/jobs/57965808-firmware-engineer
Firmware Engineer @ Morse Micro | Blackbird Job Board
Search job openings across the Blackbird network.
firmware engineermorsemicroblackbirdjob
https://www.hireroo.com/jobs/cmo8gn1jf000gm6bgay0soerk
Firmware Engineer (Senior) | Hireroo | Hireroo
Our client is expanding their engineering team and is looking for a Senior Firmware Engineer to contribute to the development of embedded software...
firmware engineersenior
https://www.cake.me/companies/logitech/jobs/21974d0688c11000976ee4ab97b80000-lead-firmware-engineer-c5b773426b7c9172e1855c9a973cc1
Lead Firmware Engineer - Logitech | Cake
Apply for job openings at Logitech now. Job description: none
firmware engineerleadlogitechcake
https://jobs.anitab.org/companies/google-24698/jobs/77326516-firmware-engineer-modem-nas-protocol-and-emergency-call-performance-improvement
Firmware Engineer, Modem NAS Protocol and Emergency Call Performance Improvement @ Google |...
Join the AnitaB.org Job Board and Talent Network to search for jobs, explore companies, and upload your resume to find opportunities tailored just for you!
firmware engineeremergency callperformance improvementmodemnas
https://jobs.innovationbay.com/companies/excelero-storage/jobs/70382698-mcu-firmware-engineer
MCU Firmware Engineer @ Excelero Storage | Innovation Bay Job Board
Search job openings across the Innovation Bay network.
firmware engineermcustorageinnovationbay
https://jobs.645ventures.com/companies/nanit/jobs/50752310-firmware-engineer
Firmware Engineer @ Nanit | 645 Ventures Job Board
Search job openings across the 645 Ventures network.
firmware engineernanitventuresjobboard
https://www.builtinnyc.com/job/senior-firmware-engineer/4478753
Senior Firmware Engineer, OpenBMC - CoreWeave | Built In NYC
CoreWeave is hiring for a Senior Firmware Engineer, OpenBMC in New York, NY, USA. Find more details about the job and how to apply at Built In NYC.
senior firmware engineeropenbmccoreweavebuiltnyc
https://www.hirekit.co/salary-guide/firmware-engineer/new-york-city
Firmware Engineer Salary in New York City, NY (2026) | HireKit | HireKit
Discover Firmware Engineer salaries in New York City, NY. Entry-level: $177,650-$252,450. Senior: $327,250-$392,700.
new york city nyfirmware engineersalary
https://www.atlasied.com/career/CareerView/c62c8759-db36-48ed-9e0e-7a2b4eee2cc3
DSP Firmware Engineer - Salt Lake City, UT | AtlasIED
The DSP/Firmware Engineer role at AtlasIED involves the development of embedded Audio DSP and firmware and participation in Audio and Vision AI projects. This...
salt lake city utfirmware engineerdspatlasied
https://jobs.embedsysweekly.com/job/Ykg8xlaY/senior-firmware-engineer
Senior Firmware Engineer at Baker Hughes
Nov 1, 2022 - Baker Hughes is hiring a Senior Firmware Engineer
senior firmware engineerbakerhughes
https://jobs.movementsearch.com/firmware-engineer-9/
Firmware Engineer | Movement
firmware engineermovement
https://jobs.mitalent.org/job-seeker/job-details/JobCode/378475993
Job Opportunity: Firmware Engineer at Warren, MI 48093 - Job Code: 378475993
Apply to work as a Firmware Engineer at Direct Employers in Warren, MI 48093 - Job Code: 378475993
job opportunityfirmware engineerwarren micode
https://jobs.sagavc.com/companies/anduril/jobs/76915386-firmware-engineer-intern
Firmware Engineer Intern @ Anduril | Saga Ventures Job Board
Search job openings across the Saga Ventures network.
firmware engineerinternandurilsagaventures
https://www.careercircle.com/jobs/all/all/usa/in/gary/5895b6e4-cff4-4165-93b9-f9608da47a5e
Firmware Engineer at Actalent in Gary, IN | CareerCircle | 5895b6e4
Find information about the Firmware Engineer jobs in Gary, IN, and other Actalent jobs at CareerCircle.com. Visit to browse Actalent jobs and fill out job...
firmware engineergary
https://jobs.embedsysweekly.com/job/Vrmnzmpw/firmware-engineer
Firmware Engineer at SteelSeries
Mar 12, 2022 - SteelSeries is hiring a Firmware Engineer
firmware engineersteelseries
https://jobs.ashbyhq.com/echo/8a348e25-7864-4e41-a38a-b7263e0fdf21/application
Firmware Engineer @ Echo Neurotechnologies
COMPANY OVERVIEW Echo Neurotechnologies is an exciting new startup in the Brain-Computer Interface (BCI) space, driving innovation through advanced hardware...
firmware engineerechoneurotechnologies
https://biotechnologyjobs.co.uk/jobs/senior-embedded-firmware-engineer-cure-talent-hathern
Senior Embedded Firmware Engineer - Cure Talent - Hathern | Biotechnology Jobs
Cure Talent are delighted to be partnered with an emerging wearable medical technology company at a defining stage of its growth. Developing next generation...
embedded firmware engineerseniorcuretalenthathern
https://www.finalroundai.com/interview-questions/nvidia-senior-firmware-engineer-embedded-controller-interview-strategies
Senior Firmware Engineer Secrets: Best Project Management Strategies?
Uncover how Nvidia's Senior Firmware Engineers manage projects efficiently to meet deadlines. Gain key insights and professional advice.
senior firmware engineerbest project managementsecretsstrategies
https://truelifeministry.org/job-library/job/bmc-firmware-engineer-at-experis-austin-tx-YjNxM3ZwU0dDY0N2c3phYWRhYUs3aENBSnc9PQ==
BMC Firmware Engineer job at Experis Austin, TX, US - truelifeministry.org
BMC Firmware Engineer job at Experis Austin, TX, US ...touch with you to discuss this great opportunity. We look forward to speaking with you! About...
firmware engineeraustin txbmcjob
https://www.interviews.chat/star-questions/firmware-engineer
Behavioral Interview Questions for Firmware Engineer (STAR Method Answers)
Explore the most common behavioral interview questions for Firmware Engineer with STAR Method answers to help you prepare and land the job.
behavioral interviewfirmware engineerstar methodquestionsanswers
https://jobs.movementsearch.com/embedded-software-engineer-73/
Firmware Engineer | Movement
firmware engineermovement
https://web.haystackapp.io/firmware-engineer/chester
Firmware Engineer Jobs in Chester | Haystack
Discover your next tech opportunity with Haystack.
firmware engineerjobschesterhaystack
https://careers.qualcomm.com/careers/job/446715793943-uefi-firmware-engineer-staff-san-diego-california-united-states-of-america?domain=qualcomm.com
UEFI Firmware Engineer, Staff | Qualcomm
Develop and maintain UEFI firmware modules and related boot components. Implement and debug platform initialization code for ARM or RISC-V systems. Collaborate...
firmware engineeruefistaffqualcomm
https://jobs.industrialinnovationfund.amazon/companies/agility-robotics/jobs/74689231-staff-firmware-engineer
Staff Firmware Engineer @ Agility Robotics | Industrial Innovation Fund Job Board
Search job openings across the Industrial Innovation Fund network.
firmware engineeragility roboticsindustrial innovationstafffund
https://careers.bluewing.vc/companies/anduril/jobs/57562025-software-engineer-eagleeye-displays-vr
Firmware Engineer, EagleEye, Displays (VR) @ Anduril | BlueWing Job Board
Search job openings across the BlueWing network.
firmware engineereagleeyedisplaysvranduril
https://formaka.fr/jobs/job/senior-firmware-engineer-at-sgs-consulting-washington-dc-ZTBBOVVxWm1SMVFjYUYvaVQvSGdacTJ5QWc9PQ==
Senior Firmware Engineer job at SGS Consulting Washington DC, US - formaka.fr
Senior Firmware Engineer job at SGS Consulting Washington DC, US ...Job Responsibilities: Develop firmware to integrate display pipeline with off the shelf...
senior firmware engineer
https://jobs.thegarage.northwestern.edu/companies/salient-motion/jobs/48296248-senior-firmware-engineer
Senior Firmware Engineer @ Salient Motion | The Garage Job Board
Search job openings across the The Garage network.
senior firmware engineerthe garagesalientmotionjob
https://www.truelancer.com/freelancer/prabhakarbitla
Prabhakar Bitla - Firmware Engineer - Freelancer from Mumbai, India
Contact Prabhakar Bitla to Hire Firmware Engineer, Freelancer from Mumbai, India. Find Professioanl Freelancers and Experts for your Project with Truelancer.
firmware engineerprabhakarfreelancermumbaiindia
https://jobs.thirdsphere.com/companies/mill/jobs/52224645-firmware-engineer
Firmware Engineer @ Mill | Third Sphere Job Board
Search job openings across the Third Sphere network.
firmware engineermillthirdspherejob
https://www.fireboard.com/careers/embedded-firmware-engineer/
Embedded Firmware Engineer - FireBoard Labs
Embedded Firmware Engineer Kansas City, MO | Full-Time | Competitive Salary (Commensurate with Experience) FireBoard Labs, a fast-growing technology company in...
embedded firmware engineerfireboardlabs
https://jobs.unreasonablegroup.com/companies/sungreenh2/jobs/72555818-embedded-firmware-engineer
Embedded Firmware Engineer @ SunGreenH2 | Unreasonable Job Board
Search job openings across the Unreasonable network.
embedded firmware engineerunreasonablejobboard
https://corptocorp.org/firmware-engineer-minneapolis-mn-fully-onsite/
Firmware Engineer :: Minneapolis, MN (Fully Onsite) | Corp to Corp
Max Rate - $55/Hr on C2C (ALL INCLUSIVE)
firmware engineerminneapolis mnfullyonsitecorp
https://www.calnetix.com/careers/lead-embedded-firmware-engineer
Lead Embedded Firmware Engineer | Calnetix Technologies
embedded firmware engineerleadtechnologies
https://www.hirekit.co/salary-guide/firmware-engineer/boston
Firmware Engineer Salary in Boston, MA (2026) | HireKit | HireKit
Discover Firmware Engineer salaries in Boston, MA. Entry-level: $139,650-$198,450. Senior: $257,250-$308,700.
firmware engineerboston masalary
https://jobs.sandscapitalventures.com/companies/anduril/jobs/57562025-software-engineer-eagleeye-displays-vr
Firmware Engineer, EagleEye, Displays (VR) @ Anduril | Sands Capital Job Board
Search job openings across the Sands Capital network.
firmware engineereagleeyedisplaysvranduril
https://careers.bluewing.vc/companies/anduril/jobs/50941026-principal-firmware-engineer-motor-control-actuators
Principal Firmware Engineer (Motor Control & Actuators) @ Anduril | BlueWing Job Board
Search job openings across the BlueWing network.
firmware engineermotor controlprincipalactuatorsanduril
https://jobs.longjourney.vc/companies/anduril/jobs/76027330-senior-firmware-engineer-embedded-systems
Senior Firmware Engineer, Embedded Systems @ Anduril | Long Journey Ventures Job Board
Search job openings across the Long Journey Ventures network.
senior firmware engineerembedded systems
https://znoydzem.com/resumes/firmware-engineer/36
CV Senior Firmware Engineer in Poland(Warsaw)
Curriculum vitae Senior Firmware Engineer in Poland(Warsaw). Find a job as a Senior Firmware Engineer in Poland by znoydzem.com
senior firmware engineercvpolandwarsaw
https://placements.twonice.com/firmware-engineer-remote-building-products-remote-national-remote/
Firmware Engineer Placement | Building Products | Foreign-Subsidiary Company | Remote / National |...
Firmware Engineer successfully placed by #twiceasnice for a Swedish-owned building products manufacturer in the Remote / National. Offer extended in 35 days....
foreign subsidiary companyfirmware engineerbuilding productsplacementremote
https://www.atlasied.com/career/CareerView/84ffa83b-8d25-4ae3-9eca-df6fed219515
Senior Firmware Engineer - Salt Lake City, UT | AtlasIED
Senior Firmware Engineer - Salt Lake City, UT
salt lake city utsenior firmware engineeratlasied
https://jobs.anitab.org/companies/amazon-3-60ad394d-c673-4474-9694-344b0cae748f/jobs/61584463-sr-firmware-engineer-annapurna-labs-machine-learning-acceleration-power-and-performance
Sr. Firmware Engineer, Annapurna Labs, Machine Learning Acceleration - Power and Performance @...
Join the AnitaB.org Job Board and Talent Network to search for jobs, explore companies, and upload your resume to find opportunities tailored just for you!
firmware engineermachine learningsrannapurnalabs
https://jobs.anitab.org/companies/apple/jobs/60459204-embedded-real-time-critical-control-firmware-engineer
Embedded Real Time Critical Control Firmware Engineer @ Apple | AnitaB.org Job Board
Join the AnitaB.org Job Board and Talent Network to search for jobs, explore companies, and upload your resume to find opportunities tailored just for you!
real timefirmware engineer
https://findwork.dev/MrJE9YM/senior-firmware-engineer-at-sanctuary-computer
Hiring Senior Firmware Engineer | Sanctuary Computer
Sanctuary Computer is hiring a Senior Firmware Engineer in remote. The tech stack includes aws, embedded, figma.
senior firmware engineerhiringsanctuarycomputer
https://jobs.generalcatalyst.com/companies/aim-intelligent-machines-2/jobs/74261045-senior-firmware-engineer
Senior Firmware Engineer @ AIM Intelligent Machines | General Catalyst Job Board
Explore thousands of opportunities within the GC portfolio.
senior firmware engineerintelligent machinesgeneral catalystaimjob
https://vindhan.com/hiring/job/senior-firmware-engineer-at-sgs-consulting-washington-dc-Y0RLandtTVhtMFF2d0VOdlVJTnc0TkVETlE9PQ==
Senior Firmware Engineer job at SGS Consulting Washington DC, US - vindhan.com
Senior Firmware Engineer job at SGS Consulting Washington DC, US ...Job Responsibilities: Develop firmware to integrate custom image sensors with an MCU....
senior firmware engineer
https://jobs.bostonscientific.com/job/Arden-Hills-Senior-Firmware-Engineer-MN-55112/1376959900/
Senior Firmware Engineer Job Details | Boston Scientific
Arden Hills Senior Firmware Engineer - MN, 55112
senior firmware engineerjob detailsbostonscientific
https://fairygodboss.com/jobs/nvidia/senior-pcie-firmware-engineer-abb05a94dec3b8f14e67cfa845caee2f
Senior PCIe Firmware Engineer at NVIDIA in Multiple Locations | Fairygodboss
NVIDIA is actively hiring a Senior PCIe Firmware Engineer in Multiple Locations . Find out more details about the job description and why you might want to...
firmware engineermultiple locationsseniorpcienvidia
https://careers.micron.com/careers/job/41441270-staff-firmware-engineer-longmont-colorado-united-states-of-america?domain=micron.com
Staff Firmware Engineer | Micron Technology
Develop and implement firmware solutions for new high-performance memory controllers and SSDs. Conduct detailed evaluation, creation, bench testing, debugging,...
firmware engineerstaffmicrontechnology
https://www.space-careers.com/job_display/281264/FPGA_Firmware_Engineer_Defense_Space_Sector_Sener_Madrid_or_Santander_Spain
FPGA/Firmware Engineer - Defense & Space Sector - Sener, Madrid or Santander
firmware engineerspace sectorfpgadefensesener
https://www.wgtech.ai/careers/firmware-engineer
Firmware Engineer | WGTech DeepInsight
firmware engineer
https://www.hacker-careers.com/job/guardian-lynx/firmware-engineer/4b365a2a-1fbd-4688-8f16-33bcc4ad2ff5
Firmware Engineer at Guardian Lynx - Remote | Hacker Careers
Join Guardian Lynx as a Firmware Engineer. Location: Remote. Tech: Embedded C, Embedded Systems, Nordic nRF53. Apply now on Hacker Careers.
firmware engineerguardianlynxremotehacker
https://www.themuse.com/jobs/apple/wireless-embedded-firmware-engineer-107699/
Wireless Embedded Firmware Engineer at Apple | The Muse | The Muse
Find our Wireless Embedded Firmware Engineer job description for Apple located in Irvine, CA, as well as other career opportunities that the company is hiring...
embedded firmware engineerwirelessapplemuse
https://jobs.movementsearch.com/embedded-firmware-engineer-7/
Firmware Engineer | Movement
firmware engineermovement
https://jobs.longjourney.vc/companies/anduril/jobs/74039232-senior-firmware-engineer
Senior Firmware Engineer @ Anduril | Long Journey Ventures Job Board
Search job openings across the Long Journey Ventures network.
senior firmware engineerandurillongjourneyventures
https://vindhan.com/hiring/job/firmware-engineer-at-sgs-consulting-washington-dc-Y3pLdnhta2ZsVTRzeFVGdldJQnk0dFlCTkE9PQ==
Firmware Engineer job at SGS Consulting Washington DC, US - vindhan.com
Firmware Engineer job at SGS Consulting Washington DC, US ...Job Responsibilities: Develop firmware to integrate display pipelines with off the shelf displays....
firmware engineerwashington dcjobsgs
https://careers.se.com/jobs/115336?lang=en-us
Firmware Engineer in Taipei, Taiwan | Schneider Electric
Schneider Electric Careers is hiring a Firmware Engineer in Taipei, Taiwan. Review all of the job details and apply today!
firmware engineertaipeitaiwanschneiderelectric
https://careers.micron.com/careers/job/41136451-staff-test-firmware-engineer-san-jose-california-united-states-of-america?domain=micron.com
Staff Test Firmware Engineer | Micron Technology
Develop Grey/white-box/black-boxoriented testing methods to verify and validate firmware product. Analyze failures from the weekly regression and root cause...
firmware engineerstafftestmicrontechnology
https://www.maw.it/offerte-di-lavoro/vr-san-bonifacio-168513
Firmware Engineer - Offerta di lavoro di MAW
firmware engineeroffertadilavoromaw
https://www.hirekit.co/salary-guide/firmware-engineer/san-francisco
Firmware Engineer Salary in San Francisco, CA (2026) | HireKit | HireKit
Discover Firmware Engineer salaries in San Francisco, CA. Entry-level: $177,650-$252,450. Senior: $327,250-$392,700.
in san franciscofirmware engineersalaryca
https://jobs.anitab.org/companies/apple/jobs/76664975-wireless-rf-phy-firmware-engineer
Wireless RF PHY Firmware Engineer @ Apple | AnitaB.org Job Board
Join the AnitaB.org Job Board and Talent Network to search for jobs, explore companies, and upload your resume to find opportunities tailored just for you!
wireless rffirmware engineerphyapplejob
https://angelandgenie.com/job-category/embedded-firmware-engineer/
Embedded Firmware Engineer - Angel and Genie - Top Executive Search Firm - Leading Recruitment...
embedded firmware engineer
https://jobs.embedsysweekly.com/job/xRmNqY6b/sr-firmware-test-engineer
Sr. Firmware Test Engineer at Enphase Energy
Jun 28, 2022 - Enphase Energy is hiring a Sr. Firmware Test Engineer
test engineersrfirmwareenphaseenergy
https://alpha-ict.in/firmware-engineer-embedded-c/
Firmware Engineer (Embedded C) - Alpha ICT
Apr 14, 2026 - we are looking for Embedded Firmware Developer with Embedded C expertise.
firmware engineerembeddedcalpha
https://www.jobtarget.com/jobs/jt-ubnmd5h94w/embedded-firmware-engineer-network-wi-fi-taipei-taipei
Embedded Firmware Engineer (Network, Wi-Fi) job near me in Taipei, Taipei at Ubiquiti Inc. | Jobs...
Apply for the Embedded Firmware Engineer (Network, Wi-Fi) job near me in Taipei, Taipei at Ubiquiti Inc.. Submit your application on JobTarget and start your...
https://www.assaabloy.com/career/en/open-positions/job.46717
Embedded Firmware Engineer | ASSA ABLOY
embedded firmware engineerassaabloy
https://www.globallogic.com/in/careers/middle-embedded-firmware-engineer-irc292145/
Middle Embedded Firmware Engineer IRC292145 | GlobalLogic India
Apr 9, 2026 - Middle Embedded Firmware Engineer IRC292145 at GlobalLogic India - Be part of our dynamic team and drive innovation and growth. Apply now and take your caree...
embedded firmware engineermiddlegloballogicindia
https://www.embedder.com/
Embedder | AI Firmware Engineer
Generate, debug, analyze, and verify firmware with deep hardware knowledge and closed-loop workflows. Supports 400+ MCUs and 2,000+ peripherals.
aifirmwareengineer
https://www.xing.com/profile/AJAIY_RAMASUBRAMANIAN
AJAIY RAMASUBRAMANIAN - Firmware Engineer - Ather Energy | XING
AJAIY RAMASUBRAMANIAN, Bangalore Professional experience, contact details, portfolio, etc.: Find out more or get in touch with AJAIY RAMASUBRAMANIAN on XING.
firmware engineerather energyxing
https://mycareers.net/jobs/firmware-software-engineer-v-redmond-washington-12-6790970
Firmware Software Engineer V - Spectraforce | Redmond, Washington - MyCareers.Net
Apply today for the role of Firmware Software Engineer V role at Spectraforce in Redmond, Washington. Competitive salary and flexible work options available.
software engineerfirmwarevredmondwashington
https://jobs.anitab.org/companies/apple/jobs/56085271-5g-4g-cellular-layer1-control-firmware-engineer
5G/4G Cellular Layer1 Control Firmware Engineer @ Apple | AnitaB.org Job Board
Join the AnitaB.org Job Board and Talent Network to search for jobs, explore companies, and upload your resume to find opportunities tailored just for you!
firmware engineer
https://www.leonlegion.com/senior-robotics-firmware-engineer
Senior Robotics & Firmware Engineer | LeonLegion
We are seeking a highly motivated and talented Robotics Scientist/Engineer with a strong theoretical foundation in core robotics concepts to join our dynamic...
firmware engineerseniorrobotics
https://jobs.anitab.org/companies/amazon-3-60ad394d-c673-4474-9694-344b0cae748f/jobs/75240201-security-engineer-platform-security-firmware-hardware-virtualization-aws-security
Security Engineer, Platform Security (Firmware, Hardware, Virtualization), AWS Security @ Amazon |...
Join the AnitaB.org Job Board and Talent Network to search for jobs, explore companies, and upload your resume to find opportunities tailored just for you!
security engineerhardware virtualizationplatformfirmwareaws
https://jobs.anitab.org/companies/amazon-3-60ad394d-c673-4474-9694-344b0cae748f/jobs/52209514-drone-firmware-software-dev-engineer-robotics-platform-engineering
Drone Firmware Software Dev Engineer, Robotics Platform Engineering @ Amazon | AnitaB.org Job Board
Join the AnitaB.org Job Board and Talent Network to search for jobs, explore companies, and upload your resume to find opportunities tailored just for you!
https://jobs.embedsysweekly.com/job/9R0eZxvm/senior-firmware-embedded-software-engineer-mcu
Senior Firmware/Embedded Software Engineer - MCU at Samsara
Sep 5, 2022 - Samsara is hiring a Senior Firmware/Embedded Software Engineer - MCU
embedded software engineerseniorfirmwaremcusamsara
https://les-4-vents.ch/office/job/senior-power-electronics-control-firmware-engineer-at-actalent-campbell-ca-aUVDMnJaWGhoTit6RmNZeEE0NkpHc0RzdXc9PQ==
Senior Power Electronics Control Firmware Engineer job at Actalent Campbell, CA, US - les-4-vents.ch
Senior Power Electronics Control Firmware Engineer job at Actalent Campbell, CA, US Job Title: Power Electronics Control Firmware Engineer Job Description......
https://leva-eu.com/job/embedded-junior-firmware-engineer-bachelor-master-cleantron-amsterdam-nl/
Embedded Junior Firmware Engineer Bachelor/Master, Cleantron - Amsterdam (NL) - LEVA-EU
Mar 14, 2024 - Source About the job Embedded Junior Firmware Engineer Bachelor/Master Are you interested in working for an innovative and growing business? Are you interested...
firmware engineerembeddedjuniorbachelor