Robuta

https://thehumansintheloop.substack.com/
The executive summary of AI news for busy software developers. Click to read The Humans in the Loop, a Substack publication with hundreds of subscribers.
the humansloopsubstack
https://www.sciencedaily.com/releases/2014/10/141022143628.htm
BPA from thermal paper used in cash register receipts accounts for high levels of BPA in humans. Subjects studied showed a rapid increase of BPA in their blood...
thermal papercash registerreceiptsaccounthigh
https://www.sciencealert.com/humans/page/3
The science of being human. News about ancient human ancestors, social phenomena, psychology, the brain, and so much more.
the bestscience newshumanssciencealertamazing
https://www.space.com/42853-dart-asteroid-impact-defense-mission-2022.html?_ga=2.125723274.144626589.1557146595-451237343.1546541218
NASA's DART mission is on track to launch in June 2021 and collide with an asteroid called Didymos in 2022.
humansslamspacecraftasteroid
https://www.aon.com/en/events/aon-insights-series-asia/why-humans-are-the-essential-factor-in-the-success-of-artificial-intelligence-ai?collection=468f3165-06cf-4acf-bbe3-85d67cb16e21&parentUrl=/en/insights/cyber-labs/command-injection-in-multiple-snap-one-araknis-networks-products
An effective AI integration relies not only on technology and data, but also the strategic insight, creativity, and enthusiasm of your people.
humans arethe essentialfactorsuccess
https://www.wikidata.org/wiki/Q28284222
population sizein thedivergencetimelineage
https://www.myjewishlearning.com/article/humans-as-guests-in-gods-world/
Humans as Guests in God's World. Themes and Theology of Nature and the Environment in Jewish Culture. Jewish Nature and the Environment.
my jewish learninghumansguestsgodworld
https://www.aon.com/en/events/aon-insights-series-asia/why-humans-are-the-essential-factor-in-the-success-of-artificial-intelligence-ai?collection=468f3165-06cf-4acf-bbe3-85d67cb16e21&parentUrl=/en/insights/podcasts/on-aon-episode-98-how-leaders-stay-ahead-balancing-risk-and-strategic-choices
An effective AI integration relies not only on technology and data, but also the strategic insight, creativity, and enthusiasm of your people.
humans arethe essentialfactorsuccess
https://www.foxnews.com/health/possible-mystery-virus-china-could-spread-between-humans-officials
Despite the development, officials said the risk remains low.
in chinapossiblemysteryviruscould
https://securitybrief.com.au/story/ai-assistants-to-surpass-humans-in-causing-corporate-data-leaks
By 2026, AI assistants in businesses are predicted to cause more internal data leaks than human employees, raising new cybersecurity and compliance challenges.
corporate dataaiassistantssurpasshumans
https://elifesciences.org/articles/04249
Building on previous work (Meigh et al., 2013) we show that A88V, a mutation in connexin26 (Cx26) that causes Keratitis-Ichthyosis-Deafness (KID) syndrome in...
kid syndromemutationcauses
https://zeenews.india.com/world/before-humans-a-fungus-was-making-zombies-a-99-million-year-old-fly-found-trapped-in-amber-proves-it-2923018.html
Jun 27, 2025 - Before humans even walked on th earth, a fungus was creating zombies. Scientists have uncovered a haunting scene frozen in 99-million-year-old amber from...
humansfungusmakingzombiesmillion
https://hellohumans.agency/
Nov 19, 2025 - At Hello Humans we craft brands that feel real, relatable, and relentlessly human because authentic connections fuel unforgettable brands.
in adigital worldhellohumanshumanise
https://www.nextgov.com/emerging-tech/2018/11/cell-phone-radiation-can-cause-cancer-rats-next-question-what-does-it-mean-humans/152551/
The studies were nearly two decades in the making.
cell phone radiationthe nextcausecancerrats
https://www.link-9.com
Dog training,Behavioral,Protection, Naples dog training, dog trainer naples, dog training, professional dog trainer, k-9 instructor, dog protection training,
in themottoday
https://giantess.porn/videos/11087/ginary-s-giantess-adventures-giantess-paris-love-squashes-tiny-humans-in-her-kitchen/
Watch Ginary's Giantess Adventures - Giantess Paris Love Squashes Tiny Humans In Her Kitchen on Giantess.porn! 🔥 Explore thousands of HD XXX giantess porn...
paris loveginarygiantessadventuressquashes
https://www.sciencedaily.com/releases/2007/11/071128105543.htm
Like us, our canine friends are able to form abstract concepts. Scientists have shown for the first time that dogs can classify complex color photographs and...
like humans dodogsclassifycomplexphotos
https://www.vecteezy.com/vector-art/8856889-collection-of-elderly-people-avatar-characters-old-humans-avatars-in-cartoon-style
Download the Collection of elderly people avatar characters. Old humans avatars in cartoon style 8856889 royalty-free Vector from Vecteezy for your project and...
elderly peopleold humanscollectionavatarcharacters
https://www.frontiersin.org/journals/cell-and-developmental-biology/articles/10.3389/fcell.2023.1168050/full
Actin filaments help in maintaining cell structure and coordinating cellular movements and cargo transport within the cell. Actin participates in interaction...
in humansfrontierscensusactinassociated
https://www.fox13news.com/news/rat-lungworm-cuban-tree-frogs-in-florida-carrying-parasite-that-could-be-deadly-to-pets-humans
Experts are warning about the rat lungworm parasite.
rat lungwormtree frogsin floridacubancarrying
https://sciencedaily.com/releases/2025/11/251114094525.htm
Researchers uncovered how fatty molecules called ceramides trigger acute kidney injury by damaging the mitochondria that power kidney cells. By altering...
kidney damagescientistsreversemicehope
https://www.mirror.ai/
Industry Experts providing deep subject matter expertise in AI applications
in the loopmirrorexperthumans
https://theworld.org/stories/2025/10/20/migrating-elephants-are-causing-more-encounters-with-humans-in-populated-areas-of-southern-india
For the first time, elephants can be seen in the southern Indian state of Andhra Pradesh, as they are pushed out of their natural habitats for varying reasons....
migratingelephantscausingencountershumans
https://worldisraelnews.com/watch-irans-robotic-revolution-exposed-just-two-humans-in-tin-foil/
Nov 28, 2025 - The expo, meant to highlight Iran's innovations, instead turned into a meme factory, highlighting the gap between state claims and reality.
watchiranroboticrevolutionexposed
https://www.nomadhumans.com/
Nomad Humans is a Coliving in Tulum, Private appartments, shared experiences. We craft experiences by bringing together local community and travelers
quintana roonomadhumanscolivingtulum
https://www.naturalnews.com/2018-10-18-avian-flu-has-spread-for-the-first-time-to-a-human.html
The first diagnosed human case of H7N4 bird flu has appeared in eastern China, reported a New Scientist article. Chinese authorities have confirmed that a...
bird fluin chinesethe whoevolvingpoultry
https://www.cbsnews.com/boston/video/bears-have-lost-their-fear-of-humans-in-new-hampshires-white-mountains-forest-service-says/
Bears in New Hampshire's White Mountains have been following campers in search of food.
new hampshirebearslostfearhumans
https://remunerationlabs.substack.com/p/sam-altman-claims-agi-is-coming-in
sam altmancoming inclaimsagimachines
https://www.aon.com/en/events/aon-insights-series-asia/why-humans-are-the-essential-factor-in-the-success-of-artificial-intelligence-ai?collection=468f3165-06cf-4acf-bbe3-85d67cb16e21&parentUrl=/en/insights/articles/climate-change-plugging-the-growing-risk-gap
An effective AI integration relies not only on technology and data, but also the strategic insight, creativity, and enthusiasm of your people.
humans arethe essentialfactorsuccess
https://aclanthology.org/2020.emnlp-main.535/
Hui Su, Xiaoyu Shen, Zhou Xiao, Zheng Zhang, Ernie Chang, Cheng Zhang, Cheng Niu, Jie Zhou. Proceedings of the 2020 Conference on Empirical Methods in Natural...
in aclosed domainacl anthologychatlike
https://www.frontiersin.org/journals/neuroscience/articles/10.3389/fnins.2021.791510/full
The influence of higher nervous activity on the processes of autonomic control of the cardiovascular system and baroreflex regulation is of considerable inte...
frontierssynchronizationprocessesautonomiccontrol
https://www.livescience.com/49411-what-beagles-reveal-about-alzheimers-in-humans.html
Dogs may be very well suited to help us understand how these lifestyle factors help our brains as we get older.
in humanslive sciencebeaglesrevealalzheimer
https://www.livescience.com/animals/land-mammals/chimps-go-through-menopause-that-could-shed-light-on-how-it-evolved-in-humans
Researchers have found evidence suggesting wild chimpanzees in Uganda's Kibale National Park go through menopause, shedding light on the evolution of this rare...
light onchimpsgomenopausecould
https://www.livescience.com/archaeology/some-of-the-1st-ice-age-humans-who-ventured-into-americas-came-from-china-dna-study-suggests
The first wave of humans into the Americas during the last ice age may have hailed partly from northern China, according to a DNA study of ancient and modern...
ice agehumans
https://www.sciencealert.com/humans
The science of being human. News about ancient human ancestors, social phenomena, psychology, the brain, and so much more.
the bestscience newshumanssciencealertamazing
https://catch-muri.org/alums/Baptiste%20Prebot.html
CATCH alum, Baptiste Prebot, was previously a postdoctoral researcher at Carnegie Mellon University. Baptiste received his Ph.D. in Cognitive Engineering from...
drbaptistejointmuricybersecurity
https://www.foxbusiness.com/personal-finance/ai-financial-advisors-coming-and-may-outperform-humans-guarding-your-money
A seasoned financial advisor with 34 years of experience argues AI may soon provide better financial advice than humans, citing emotional decision-making that...
financial adviserswealth managementaimaysoon
https://www.slu.edu/news/2022/november/water-institute-microplastics-meramec-river.php
A team of researchers, led by Jason Knouft, Ph.D., and Elizabeth Hasenmueller, Ph.D., studied levels of microplastics at 19 sites along the Meramec River,...
end uphumanslivemicroplasticsrivers
https://www.livescience.com/33431-why-humans-walk-circles.html
In the absence of landmarks, people curve around in tight loops, all the while believing themselves to be walking in straight lines. Recent research has made...
walk inlive sciencehumanscircles
https://www.pasteur.fr/en/research-journal/news/new-stem-cell-model-study-sex-determination-humans
A stem cell model allows researchers to observe the earliest stages of sex determination in humans. This could help uncover why some people are born without a...
a newstem cellstudy sexmodeldetermination
https://www.umweltprobenbank.de/en/documents/news/28252
Latest data and assessments published in peer reviewed journals
in humansthe environmentnewpublicationsonline
https://pubmed.ncbi.nlm.nih.gov/14736926/
Our investigation documents the isolation and identification of monkeypox virus from humans in the Western Hemisphere. Infection of humans was associated with...
in humanswestern hemispheredetectionmonkeypox
https://www.technologynetworks.com/genomics/news/parts-of-our-dna-may-evolve-much-faster-than-previously-thought-399051
New research uncovers rapid DNA changes in humans, offering insights into disease risks and evolutionary processes. Explore the findings.
in humansstudyrevealsfasterdna
https://www.birmingham.ac.uk/news-archive/2020/anti-covid-19-nasal-spray-ready-for-use-in-humans
Anti-COVID-19 nasal spray 'ready for use in humans'
nasal sprayfor usein humansanticovid
https://www.cbsnews.com/news/washington-resident-dies-rare-bird-flu-strain/
Nov 22, 2025 - The man, an older adult with underlying health conditions, was being treated for a type of bird flu called H5N5.
washington statebird fluresidentdiescontracting
https://www.healthline.com/health/list-of-dominant-and-recessive-traits-in-humans?utm_source=ReadNext
Sep 2, 2025 - Your genes are responsible for your traits. Some are dominant and appear if you receive a copy from one parent. Others are recessive and only apparent if you...
dominant and recessivelist oftraitshumans
https://www.ucsf.edu/news/2011/09/103913/obesity-clues-humans-may-be-unearthed-first-worm
Obesity research in overweight humans may soon be guided by genetic studies of eating behavior, metabolism and fat storage in the nematode worm, C elegans.
in humansarchiveobesitycluesmay
https://pubmed.ncbi.nlm.nih.gov/12614846/
Dietary nitrate is metabolized to nitrite by bacterial flora on the posterior surface of the tongue leading to increased salivary nitrite concentrations. In...
the effectdietarynitratesalivaryplasma
https://www.sciencedaily.com/releases/2009/06/090629200840.htm
In a study with important consequences for studies on the effects of chemicals on steroid responses in humans, scientists have found that -- contrary to...
toxic chemicalssteroid hormonesin humansaffectdifferently
https://www.newslab.sk/strongyloides-infections-in-humans-and-other-reservoir-hosts-in-dzanga-sangha-protected-areas-central-african-republic/
in humansstrongyloidesinfectionsreservoirhosts
https://www.ucf.edu/pegasus/stellar-health/
May 29, 2024 - UCF College of Medicine researchers are exploring how space travel impacts the human body, which is increasingly important to study.
humans in spacestellarhealthexamining
https://www.illyriad.co.uk/GameInformation/Races/Humans
humansillyriad
https://www.aon.com/en/events/aon-insights-series-asia/why-humans-are-the-essential-factor-in-the-success-of-artificial-intelligence-ai?collection=468f3165-06cf-4acf-bbe3-85d67cb16e21&parentUrl=/en/insights/articles/using-parametric-insurance-to-close-the-earthquake-protection-gap
An effective AI integration relies not only on technology and data, but also the strategic insight, creativity, and enthusiasm of your people.
humans arethe essentialfactorsuccess
https://ourworldindata.org/wild-mammals-birds-biomass
Dec 1, 2025 - Humans and livestock make up 95% of the world’s mammal biomass; wild mammals are just 5%.
all of thealmostmammalbiomasshumans
https://pubmed.ncbi.nlm.nih.gov/30639358/
GDF15 is an established biomarker of cellular stress. The fact that it signals via a specific hindbrain receptor, GFRAL, and that mice lacking GDF15 manifest...
providesendocrinesignalnutritionalstress
https://openstax.org/books/biology/pages/22-4-bacterial-diseases-in-humans
There are records about infectious diseases as far back as 3000 B.C. A number of significant pandemics caused by bacteria have been documented over seve...
bacterial diseasesin humansbiologyopenstax
https://www.aon.com/en/events/aon-insights-series-asia/why-humans-are-the-essential-factor-in-the-success-of-artificial-intelligence-ai?collection=468f3165-06cf-4acf-bbe3-85d67cb16e21&parentUrl=/en/insights/articles/pension-reform-navigating-the-future-of-retirement
An effective AI integration relies not only on technology and data, but also the strategic insight, creativity, and enthusiasm of your people.
humans arethe essentialfactorsuccess
https://www.nationalgeographic.com/science/article/2017-times-nature-outmatched-humans-spd
Other than wildfires, hurricanes, floods, and the like.
national geographictimesnatureoutmatchedhumans
https://imbue.com/?ref=dataphoenix.info
We build products that give people power over their digital world, from modifying algorithms and agents, to building personal software you can trust.
in theai agetoolsempowerhumans
https://www.sciencedaily.com/releases/2015/08/150804093726.htm
A new study opens the field to new understanding of the molecular mechanism underlying addiction in humans. The team found that humans with mutation of a key...
in humansunderstandingmolecularmechanismleading
https://openreview.net/forum?id=rkWWtaZuZH&referrer=%5Bthe%20profile%20of%20Amy%20Zhao%5D(%2Fprofile%3Fid%3D~Amy_Zhao1)
We address the computational problem of novel human pose synthesis. Given an image of a person and a desired pose, we produce a depiction of that person in...
imageshumansunseenposes
https://majestic.com/seo-in-2024/jess-joyce
Nov 28, 2023 - Be human in order to sell to humans - with Jess Joyce
be humanordersellhumansjess
https://www.sciencealert.com/humans/page/8
The science of being human. News about ancient human ancestors, social phenomena, psychology, the brain, and so much more.
the bestscience newshumanssciencealertamazing
https://www.news-medical.net/news/20251006/New-experimental-methods-show-selective-attention-effect-is-exclusively-cortical-in-humans.aspx
Research led by the University of Michigan's Kresge Hearing Research Institute and the University of Rochester illuminates the mechanisms through which humans...
selective attentionnewexperimentalmethodsshow
https://news.harvard.edu/gazette/story/2025/10/in-dogs-as-in-humans-a-harsh-past-might-bare-its-teeth/
Oct 13, 2025 - Early adversity leads to higher aggression and fearfulness in adult canines, according to a new Harvard study.
dogshumansharshpastmight
https://www.designboom.com/architecture/goa-open-air-theater-china-birds-humans-same-stage-12-02-2025/
Dec 2, 2025 - GOA completes the earth valley theater in yixing, jiangsu, china, a rare performance venue conceived as a shared system for birds and people.
open air theaterin chinagoacraftsbirds
https://pubmed.ncbi.nlm.nih.gov/7753877/
The desensitization effects on taste resulting from application of 100 or 10 ppm capsaicin, accompanied by daily testing of a capsaicin series (1-1000 ppm, in...
in humanseffectscapsaicindesensitizationtaste
https://www.techtimes.com/articles/89453/20151001/google-wants-to-make-its-self-driving-cars-drive-like-humans-is-the-future-of-road-safety-in-trouble.htm
Google is making its driverless cars act in a more 'humanistic' fashion. Will introducing human features beat the project's entire purpose of removing human...
self driving carsgooglewantsmakedrive
https://www.chinilab.com/publications/chini-neural-2019/
Monitoring the hypnotic component of anesthesia during surgeries is critical to prevent intraoperative awareness and reduce adverse side effects. For this...
neural correlatesanesthesianewbornmicehumans
https://www.deccanchronicle.com/technology/in-other-news/270120/uber-self-driving-cars-with-humans-in-control-to-cruise-friday.html
Uber is operating self-driving cars in autonomous mode with safety drivers behind the wheel.
self driving carsuberhumanscontrolcruise
https://pubmed.ncbi.nlm.nih.gov/8513975/
Treatment with glucocorticoids is associated with a disproportionate elevation in the PI/IRI ratio. To determine whether growth hormone--another agent capable...
growth hormone treatmenteffectglucocorticoidproinsulinlevels
https://pubmed.ncbi.nlm.nih.gov/32285168/
Phosphate homeostasis involves several major organs that are the skeleton, the intestine, the kidney, and parathyroid glands. Major regulators of phosphate...
in humanscauseshypohyperphosphatemia
https://majestic.com/seo-in-2023/isaline-muelhauser
Nov 24, 2023 - Treat translations like languages and your audience like humans - with Isaline Muelhauser
treattranslationslikelanguagesaudience
https://www.wionews.com/world/study-reveals-extreme-weather-to-impact-70-of-humans-in-the-next-20-years-759097
WION (World Is One News) brings latest & breaking news from South Asia, India, Pakistan, Bangladesh, Nepal, Sri Lanka and rest of the World in politics,...
extreme weatherper centimpacthumans
https://pubmed.ncbi.nlm.nih.gov/10511637/?dopt=Abstract
The aim of this study was (1) to provide behavioral evidence for multimodal feature integration in an object recognition task in humans and (2) to characterize...
object recognitionin humansauditoryvisualintegration
https://www.skeptic.com/michael-shermer-show/logic-creativity-and-the-limits-of-ai-how-humans-think-in-ways-machines-never-will/
About this episode: In this episode, Angus Fletcher explains why the human brain doesn’t work like a computer and why our deepest strengths come not from...
the limitslogiccreativityaihumans
https://www.brusselstimes.com/264126/tiger-population-in-nepal-triples-but-attacks-on-humans-increase
While the increasing tiger population is welcomed by many, at least 62 people in Nepal have lost their lives in attacks by tigers in the last three years.
tigerpopulationnepaltriplesattacks
https://ojp.gov/library/publications/abundant-contribution-short-tandem-repeats-gene-expression-variation-humans
Since the contribution of repetitive elements to quantitative human traits is largely unknown, this article reports on a genome-wide survey of the contribution...
short tandem repeatsgene expressionabundantcontributionvariation
https://www.sciencealert.com/humans/page/6
The science of being human. News about ancient human ancestors, social phenomena, psychology, the brain, and so much more.
the bestscience newshumanssciencealertamazing
https://www.popsci.com/article/science/how-it-works-putting-humans-suspended-animation/
A new human trial will chill gunshot victims to keep them alive
how it workssuspended animationputtinghumans
https://pubmed.ncbi.nlm.nih.gov/11487664/
The photopigment in the human eye that transduces light for circadian and neuroendocrine regulation, is unknown. The aim of this study was to establish an...
action spectrumin humansmelatoninregulationevidence
https://futurism.com/elon-musk-just-outlined-his-plans-for-getting-humans-to-mars-in-reddit-ama
Elon Musk participated in an AMA discussing is plans for Mars colonization. There is still much for SpaceX to figure out before attempting the first manned...
elon muskoutlinedplansgettinghumans
https://pubmed.ncbi.nlm.nih.gov/27023418/
Although animal models have consistently demonstrated acute pain inhibitory effects of nicotine and tobacco, human experimental studies have yielded mixed...
in humansacuteanalgesiceffectsnicotine
https://pubmed.ncbi.nlm.nih.gov/27876809/
A basic property of endothermic thermoregulation is the ability to generate heat by increasing metabolism in response to cold ambient temperatures to maintain...
in humanscoldinducedthermogenesis
https://aiagentsdirectory.com/blog/the-final-bottleneck-in-ai-coding-why-humans-are-now-the-slowest-step-in-software-development
Mar 4, 2026 - AI coding tools are removing traditional software development limits — but creating a new bottleneck: human understanding and review. Learn why the future of...
the finalhumans arebottleneckaicoding
https://elifesciences.org/articles/49734
Human participants fail to discriminate between odor sequences that activate the same neurons at different orders, pointing against a substantial role for...
temporal codingcontributionodor
https://foolishkingmedia.com/toh-facesmalden-101522
Live at Faces Brewhouse Malden MA - Oct 15, 2022
live in concertthe onlypaulkravitzhumans
https://laughingsquid.com/father-and-son-pigs-expertly-ride-the-waves-in-hawaii-along-with-surfing-father-and-son-humans/
Kama, the amazing pig who surfs with his human Kai Holt, is the proud papa to Kama 2 an adorable little black piglet who enjoys riding the waves with
father and sonpigsexpertlyridewaves
https://www.frontiersin.org/journals/psychology/articles/10.3389/fpsyg.2024.1415958/full
The experiments allowed by current machine learning models imply a revival of the debate on the causes of specific trends of human visual psychophysics. Mach...
of colorin humansimage segmentationfrontiersalignment
https://webstr.ucsd.edu/
short tandem repeatpopulationwidedatabasevariation
https://cmmonline.com/news/latest-bird-flu-case-involves-strain-never-before-reported-in-humans
Nov 24, 2025 - A Grays Harbor, Washington, resident, who was hospitalized with influenza symptoms in early November, has been confirmed to have influenza A H5, a type of bird...
bird flunever beforelatestcasestrain
https://www.itpro.com/business-intelligence/27550/ai-may-replace-humans-in-lower-middle-skilled-jobs
A government report outlines some of the jobs that AI is likely to substitute
aimayreplacehumanslower
https://pubmed.ncbi.nlm.nih.gov/12700159/
Little is known about amino acid (AA) and protein metabolism in lactating women. We hypothesized: 1) AA sources other than the plasma acid pool provide...
protein homeostasismaternalmilksynthesisfeeding
https://www.sciencealert.com/humans/page/9
The science of being human. News about ancient human ancestors, social phenomena, psychology, the brain, and so much more.
the bestscience newshumanssciencealertamazing
https://www.cmswire.com/customer-experience/why-modern-customer-centricity-needs-both-the-ai-and-human-touch/
Nov 2, 2023 - The key to success with AI is leveraging these innovations to build authentic relationships with your customers.
a matchmade inaihumanstogether
https://www.sciencedaily.com/releases/2009/12/091203132157.htm
Biodiversity loss can increase infectious diseases in humans, scientists show in a first-of-its-kind global study.
biodiversity lossinfectious diseasesincreasehumanssciencedaily
https://mymodernmet.com/ariana-heinzman-clay-vessels/
Artist Ariana Heinzman creates colorful vessels with bold designs. Inspired by nature, they are stand-ins for the human figure.
inspired bycolorfulceramicsnaturestand
https://www.inverse.com/science/humans-speech-screaming-vocal-cords-evolution
A study looks at how human loss of vocal membranes, which are present in primates, simplified the larynx and led to the capability of more sophisticated speech.
gave uphumansscreamingfavorspeaking
https://rapescenesite.com/en/video/970740636502327590/
Dolphins Raping Humans - girl gets violently drunk and anal raped in a brutal rape sex scene. - Girl Getting Raped By Lesbian - 6:57 - 10.09.2023 - 31
rape scenegirl getssitedolphinsraping
https://pubmed.ncbi.nlm.nih.gov/11509489/
Age-related endothelial dysfunction could be caused by an alteration in the L-arginine-NO system and the production of oxidative stress in both normotensive...
oxidative stressagerelatedreductionavailability