Robuta

https://www.endocrinologyadvisor.com/ Endocrinology, Diabetes News | Endocrine Treatment & Research Jan 27, 2026 - A free diabetes, endocrinology and medical news article resource for endocrinologists and physicians. Endocrinology conference coverage and drug information. diabetes newsendocrinologyendocrinetreatmentresearch https://www.endocrine.org/ Endocrine.org | Endocrine Society Endocrine Society is a global community of 18,000-plus endocrine investigators and clinicians more than 100 countries. Members focus on improving patient care,... endocrinesociety https://heeds.org/ HEEDS – Healthy Environment and Endocrine Disruptor Strategies healthy environmentendocrine disruptorheedsstrategies https://endo-ern.eu/ EU Reference Network Rare Endocrine Conditions ~ Endo ERN endocrine conditionseureferencenetworkrare https://cesqip.org/ Collaborative Endocrine Surgery Quality Improvement Program (CESQIP quality improvement programendocrine surgerycollaborative https://aaes.memberclicks.net/job-posting-submission American Association of Endocrine Surgeons american associationendocrinesurgeons https://endocrinenyc.com/ Endocrine Associates of West Village PC | NYC & Long Island west villageendocrineassociatespcnyc https://endocrine-bay.org/ Endocrine Bay | endocrinebay https://www.endocrine.org/news-and-advocacy/news-room/2017/endocrinologists-want-training-in-transgender-care Endocrinologists Want Training in Transgender Care | Endocrine Society Four out of five physicians who specialize in treating hormone health conditions have never received formal training on care for transgender individuals,... transgender careendocrinologistswanttrainingendocrine https://lwpes.org/ Pediatric Endocrine Society pediatricendocrinesociety https://jpes.org.pk/index.php/jpes Journal of Pakistan Endocrine Society journalpakistanendocrinesociety https://pedsendo.org/ Home - Pediatric Endocrine Society May 27, 2026 - Advance and promote the endocrine health of children, adolescents and young adults and support the professionals that work on their behalf Learn More Clinical... pediatricendocrinesociety https://www.c-linkage.co.jp/icejes2026/ The 22nd International Congress of Endocrinology / The 99th Annual Congress of The Japan Endocrine... Website for the 22nd International Congress of Endocrinology to be held at Kyoto International Conference Center, Kyoto, Japan, June 2 (Tue) - 5 (Fri), 2026... international congressendocrinologyannualjapanendocrine https://pure.psu.edu/en/publications/endocrine-disrupting-effects-on-the-nesting-behaviour-of-male-thr/ Endocrine disrupting effects on the nesting behaviour of male three-spined stickleback Gasterosteus... https://shop.elsevier.com/books/handbook-of-endocrine-investigations-in-children/hughes/978-0-7236-0719-9 Handbook of Endocrine Investigations in Children - 1st Edition | Elsevier Shop in childrenhandbookendocrineinvestigationsedition https://pubmed.ncbi.nlm.nih.gov/38576015/ Association of maternal exposure to endocrine disruptor chemicals with cardio-metabolic risk... Prenatal exposure to the EDCs in the uterine period could increase the risk of obesity in children. Maternal exposure to bisphenol-A and pesticides showed the... endocrine disruptor https://procareers.diabetes.org/jobs/22001631/vice-president-endocrine-services-northwell-health Vice President, Endocrine Services, Northwell Health in New York, NY for Northwell Health Exciting opportunity in New York, NY for Northwell Health as a Vice President, Endocrine Services, Northwell Health in new yorkvice presidentendocrine servicesnorthwell health https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=607dd42d-5b41-4c0a-8499-83763dc04ad1 DailyMed - MALE ENDOCRINE AXIS DROPS 5019- male endocrine axis drops liquid dailymedmaleendocrineaxisdrops https://umu.diva-portal.org/smash/record.jsf?pid=diva2:1753360&language=sv Intrasellar pressure is related to endocrine disturbances in patients with pituitary tumors https://rarediseases.info.nih.gov/diseases/3830/multiple-endocrine-neoplasia-type-2 Multiple endocrine neoplasia, type 2 | About the Disease | GARD Find symptoms and other information about Multiple endocrine neoplasia, type 2. multiple endocrine neoplasiaabout the diseasetypegard https://ej-endocrinology.org/ Ej Endocrinology - Your trusted source for endocrine health information Your trusted source for endocrine health information trusted sourceendocrine healthejendocrinologyinformation https://www.cordis.europa.eu/project/id/825759/results/es Novel Testing Strategies for Endocrine Disruptors in the Context of Developmental NeuroToxicity |... Deliverables, publications, datasets, software, exploitable results testing strategiesendocrine disruptors https://animalendocrine.blogspot.com/2011/03/dr-peterson-interviewed-about-feline.html Animal Endocrine Clinic: Dr. Peterson Interviewed About Feline Hyperthyroidism on Steve Dale's Pet... Dr. Mark E. Peterson talks feline hyperthyroidism during an interview with Steve Dale, the host of Steve Dale's Pet World . You may click... https://scholarworks.indianapolis.iu.edu/items/89f5d224-ca42-463e-97b3-c69253ea15da SUN-351 Sex Is a Strong Variable in the Mineral Metabolism Defects and Endocrine Dysfunction... The adenine diet is widely used in animal models to produce a tubulointerstitial fibrosis and inflammation that mimics human CKD in many aspects. These include... https://open.clemson.edu/arv_theses/3140/ "Endocrine and Metabolic Responses During the Estrous Cycle of the Ener" by Frank Neal Schrick By Frank Neal Schrick, Published on 05/01/88 https://www.frontiersin.org/journals/endocrinology/articles/10.3389/fendo.2023.1238950/full Frontiers | Editorial: Endocrine consequences of sleep disorders Sleep is a vital physiological process necessary for sustaining both physical health and optimal brain function (1-3). Despite the recommended sleep duration... frontierseditorialendocrineconsequencessleep https://secure.ssa.gov/apps10/poms.nsf/lnx/0434005109 SSA - POMS: DI 34005.109 - Endocrine Disorders - Child - 06/09/2011 Endocrine Disorders - Child endocrine disordersssapoms https://agrilifeextension.tamu.edu/asset-external/feeding-senior-horses-with-endocrine-diseases-key-differences-in-nutritional-management-between-cushings-and-metabolic-syndrome/?_rt=MTl8Mnxob3JzZXwxNzc2MTkwNzc3&_rt_nonce=9063486d41 Feeding Senior Horses with Endocrine Diseases - Key Differences in Nutritional Management Between... Mar 10, 2026 - ANSC-PU-464, Feeding Senior Horses with Endocrine Diseases - Key Differences in Nutritional Management Between Cushing's and Metabolic Syndrome, feeding senior... senior horsesendocrine diseases https://www.surgery.wisc.edu/2019/04/12/endocrine-surgery-team-shines-at-aaes-meeting/ Endocrine surgery team shines at AAES Meeting - Department of Surgery The Division of Endocrine Surgery recently shined at the American Association of Endocrine Surgeons annual meeting. Highlights include: Kristin Long, MD, and... endocrine surgeryteamshinesaaesmeeting https://bibliographie.uni-tuebingen.de/xmlui/handle/10900/109913?show=full Endocrine-resistant breast cancer: mechanisms and treatment breast cancerendocrineresistantmechanismstreatment https://experts.illinois.edu/en/publications/characterization-of-potential-endocrine-related-health-effects-at/ Characterization of potential endocrine-related health effects at low-dose levels of exposure to... https://ja.dh.duke.edu/duke-surgical-oncology-weekly-conference-2020/content/endocrine-therapy-breast-cancer Endocrine Therapy for Breast Cancer | DUKEHealth JA endocrine therapybreast cancerja https://online.flippingbook.com/view/367298853/20-21/?sharedOn= 2021 Endocrine Surgery Annual Report - Page 20-21 Elective operative cases performed Residence (continued) Case type Figure 4 shows the breakdown of the 1337 elective operative cases by case type. In 2021 th annual report pageendocrine surgery https://pubmed.ncbi.nlm.nih.gov/37328132/ A comparative review and computational assessment of acetochlor toxicity in fish: A novel endocrine... Acetochlor is a chloroacetamide herbicide applied to various crops worldwide and is one of the top selling herbicides on the global market. Due to rain events... https://experts.colorado.edu/display/meshid_A06 Endocrine System | CU Experts | CU Boulder endocrine systemcuexpertsboulder https://cebs.niehs.nih.gov/cebs/study/002-02111-0001-0000-8 77-Day Study of Endocrine Disruptor (Genistein) (446-72-0). Immunotoxicology Study | Chemical... endocrine disruptor https://pmc.ncbi.nlm.nih.gov/articles/PMC11142652/ Associations of Intrapancreatic Fat Deposition With Incident Diseases of the Exocrine and Endocrine... To investigate whether increased intrapancreatic fat deposition (IPFD) heightens the risk of diseases of the exocrine and endocrine pancreas. A prospective... https://pubmed.ncbi.nlm.nih.gov/34134123/ Erectile Dysfunction in Men on the Rise: Is There a Link with Endocrine Disrupting Chemicals? Erectile dysfunction (ED) is one of the most prevalent chronic conditions affecting men. ED can arise from disruptions during development, affecting the... https://cdn.southampton.ac.uk/research/projects/randomised-controlled-trial-evaluating-effectiveness-of-neoadjuvant-endocrine Randomised controlled trial evaluating effectiveness of neoadjuvant endocrine treatment in... Randomised controlled trial evaluating effectiveness of neoadjuvant endocrine treatment in post-menopausal women (EndoNET). randomised controlled trialevaluating effectivenessendocrinetreatment https://research.vu.nl/en/publications/metabolic-profiling-of-endocrine-disrupting-compounds-by-on-line-/ Metabolic profiling of endocrine-disrupting compounds by on-line cytochrome p450 bioreaction... https://www.aafp.org/pubs/afp/issues/2008/0901/p565.html Potential Toxicity of Synthetic Chemicals: What You Should Know About Endocrine-Disrupting... A growing body of evidence suggests that many synthetic chemicals once considered safe can be harmful to the developing fetus, infant, and child. There is... what you should knowsynthetic chemicals https://pubmed.ncbi.nlm.nih.gov/29160835/ Vitamin D and Neurological Diseases: An Endocrine View Vitamin D system comprises hormone precursors, active metabolites, carriers, enzymes, and receptors involved in genomic and non-genomic effects. In addition to... vitamin dneurological diseasesendocrineview https://drpiyushdesaiclinic.exlyapp.com/ Desai Diabetes and Endocrine Clinic diabetes and endocrinedesaiclinic https://www.frontiersin.org/research-topics/70194/drugs-of-abuse-and-their-endocrine-effects/impact Frontiers | Drugs of abuse and their endocrine effects Drugs of abuse have profound effects on the endocrine system, influencing hormonal regulation and disrupting the hypothalamic-pituitary-endocrine (HPE) axis.... drugs of abusefrontiersendocrineeffects https://apopka-fl.hgh-injections.net/ HGH therapy Apopka, FL - Endocrine Wellness Center Endocrine Wellness Center offers hgh therapy and hgh shots in Apopka, Florida. Experienced hgh doctor provides effective hgh treatment. hgh therapyapopka flendocrinewellnesscenter https://pure.psu.edu/en/publications/endocrine-disruptor-and-pharmaceutical-adsorption-on-modified-gac/ Endocrine disruptor and pharmaceutical adsorption on modified GACs: Relating performance to GAC and... endocrine disruptor https://www.epa.gov/endocrine-disruption/overview-endocrine-system?ref=goodhealthguides.com Overview of the Endocrine System | US EPA Jun 11, 2025 - Endocrine systems, also referred to as hormone systems, are found in all mammals, birds, fish, and many other types of living organisms. the endocrine systemoverview ofusepa https://endocrine-j.jp/ Endocrine Journal endocrinejournal https://pubmed.ncbi.nlm.nih.gov/35094211/?dopt=Abstract Endocrine secretory granule production is caused by a lack of REST and intragranular secretory... Endocrine secretory granules (ESGs) are morphological characteristics of endocrine/neuroendocrine cells and store peptide hormones/neurotransmitters. ESGs... https://www.semanticscholar.org/topic/Malignant-neoplasm-of-endocrine-gland/460586 Malignant neoplasm of endocrine gland | Semantic Scholar A malignant neoplasm affecting the endocrine glands. Representative examples include thyroid gland carcinoma, parathyroid gland carcinoma, pituitary gland... malignantneoplasmendocrineglandsemantic https://handbook.monash.edu/2020/units/PHY2032 PHY2032 - Endocrine control systems - Monash University This is the official site of the Monash University Handbook for course and unit information. control systemsendocrinemonashuniversity https://www.qk.sjtu.edu.cn/jimcp/EN/abstract/article/1673-6087/45292 Clinical study on characteristics of endocrine metabolism in the patients of polycystic ovary... clinical studyendocrine metabolism https://www.scirp.org/journal/paperinformation?paperid=22524 The Effects of Etomidate and Propofol Induction on Hemodynamic and Endocrine Response in Patients... https://ja.dh.duke.edu/endocrine-clinical-case-conference-fy18/endocrine-clinical-conference-fy18-28 Endocrine Clinical Conference - FY18 | DUKEHealth JA clinical conferenceendocrineja https://animalendocrine.blogspot.com/2011/04/treating-dogs-with-hypoadrenocorticism.html Animal Endocrine Clinic: Treating Dogs with Hypoadrenocorticism (Addison's Disease) Addison's disease, the common name for hypoadrenocorticism or adrenal insufficiency, as I have discussed in my last two blog posts , is a di... endocrine clinicanimaltreatingdogsaddison https://researchconnect.buffalo.edu/en/publications/endocrine-and-chronobiological-effects-of-fasting-in-women/ Endocrine and chronobiological effects of fasting in women - SUNY University at Buffalo https://endoc.cochrane.org/cochrane-resources-review-authors Resources for review authors | Cochrane Metabolic and Endocrine Disorders resources forreviewauthorscochranemetabolic https://pubmed.ncbi.nlm.nih.gov/40454634/ Elinzanetant for Vasomotor Symptoms from Endocrine Therapy for Breast Cancer Elinzanetant led to a significantly lower frequency of vasomotor symptoms associated with endocrine therapy than placebo. (Funded by Bayer; OASIS-4... endocrine therapyelinzanetantsymptomsbreastcancer https://pubmed.ncbi.nlm.nih.gov/36982755/ Endocrine Disruptor Compounds in Environment: Focus on Women's Reproductive Health and Endometriosis Endometriosis is an estrogen-dependent gynecologic illness that has long-term effects on a woman's fertility, physical health, and overall quality of life.... focus on women https://www.ideals.illinois.edu/items/49734 Molecular analyses of endocrine and nutritional factors that affect division of labor and health in... https://heartlandendocrinegroup.com/ Home - Heartland Endocrine Group, PLC heartlandendocrinegroupplc https://researchconnect.buffalo.edu/en/publications/a-28-mb-clone-contig-of-the-multiple-endocrine-neoplasia-type-1-m/ A 2.8-Mb clone contig of the multiple endocrine neoplasia type 1 (MEN1) region at 11q13 - SUNY... https://texas-endocrine.com/ Texas Thyroid and Endocrine Associates: Dr Sonia Eapen | (281) 485-7200 Endocrinologist in... https://pmc.ncbi.nlm.nih.gov/articles/PMC12066167/ Endocrine Disruptors and Their Impact on Quality of Life: A Literature Review - PMC Endocrine-disrupting chemicals (EDCs) are widespread environmental contaminants that interfere with hormonal regulation, affecting metabolism, reproduction,... quality of life https://animalendocrine.blogspot.com/2013/03/how-radioiodine-works-to-cure-cats-with.html Animal Endocrine Clinic: How Radioiodine Works to Cure Cats with Hyperthyroidism Iodine Physiology and the thyroid Thyroid hormones are the only iodinated organic compounds in the body. Ingested stable iodine (127-I)... endocrine clinicanimalradioiodine https://animalendocrine.blogspot.com/2012/03/top-10-cat-and-dog-medical-conditions.html Animal Endocrine Clinic: Top 10 Cat and Dog Medical Conditions of 2011 Nation's Largest Pet Insurer Reveals Most Common Causes of Veterinary Visits Veterinary Pet Insurance Co. (VPI), the nation's oldest and ... cat and dogendocrine clinic https://www.umweltbundesamt.de/en/tags/endocrine-active-substance endocrine active substance | Umweltbundesamt endocrineactivesubstanceumweltbundesamt https://med.emory.edu/departments/surgery/education/endocrine-surgery-fellowship/our-faculty.html Faculty | Emory Endocrine Surgery Fellowship | Emory School of Medicine endocrine surgeryschool offacultyemoryfellowship https://www.umweltbundesamt.de/en/topics/health/environmental-impact-on-people/chemical-substances/endocrine-disruptors Endocrine disruptors | Umweltbundesamt endocrine disruptorsumweltbundesamt https://pmc.ncbi.nlm.nih.gov/articles/PMC9885170/ A review of the endocrine disrupting effects of micro and nano plastic and their associated... Over the years, the vaste expansion of plastic manufacturing has dramatically increased the environmental impact of microplastics [MPs] and nanoplastics [NPs],... https://pubchem.ncbi.nlm.nih.gov/compound/Male-Endocrine-Axis-Drops-5019-_FDA-NDC_-63083-5019 Male Endocrine Axis Drops 5019 (FDA NDC: 63083-5019) - PubChem Male Endocrine Axis Drops 5019 (FDA NDC: 63083-5019) chemical information summary. maleendocrineaxisdropsfda https://www.frontiersin.org/research-topics/69788/advancing-reproductive-outcomes-integrating-molecular-metabolic-and-endocrine-insights-into-oocyte-maturation/magazine Advancing Reproductive Outcomes: Integrating Molecular, Metabolic, and Endocrine Insights into... Oocyte maturation is central to fertility treatments and reproductive health, with significant implications for both natural conception and assisted... advancingreproductiveoutcomesintegratingmolecular https://www.thelondonobesityclinic.co.in/ Home - The London Obesity & Endocrine Clinic the londonobesityendocrineclinic https://www.flaticon.com/free-icons/endocrine Endocrine Icons & Symbols 752 endocrine icons. Vector icons in SVG, PSD, PNG, EPS and ICON FONT endocrineiconssymbols https://pubmed.ncbi.nlm.nih.gov/39665585/?dopt=Abstract Active Monitoring With or Without Endocrine Therapy for Low-Risk Ductal Carcinoma In Situ: The... ClinicalTrials.gov Identifier: NCT02926911. https://academics.iu.edu/courses/indianapolis/med-x-760-endocrine-and-reproductive-biology.html ENDOCRINE & REPRODUCTIVE BIOLOGY at IU Indianapolis: Courses reproductive biologyiu indianapolisendocrinecourses https://www.cirm.ca.gov/about-cirm/publications/inhibitors-src-and-focal-adhesion-kinase-promote-endocrine-specification-impact-derivation-beta-cells-human-pluripotent-stem-cells/ Inhibitors of Src and focal adhesion kinase promote endocrine specification: impact on the... focal adhesion kinase https://www.cpeg-gcep.net/ Home | Canadian Pediatric Endocrine Group canadianpediatricendocrinegroup https://www.mayoclinic.org/medical-professionals/endocrinology/news/oncogenic-osteomalacia-pearls-from-an-elusive-tumor-a-case-from-the-endocrine-teaching-clinics/mcc-20490502 Oncogenic osteomalacia, pearls from an elusive tumor: A case from the endocrine teaching clinics -... Natalia Genere, M.D., and Robert D. Tiegs, M.D., discuss the care plan for a woman who presented with multiple, nontraumatic fractures discovered during a... https://pure.psu.edu/en/projects/core-endocrine-laboratory/ CORE--ENDOCRINE LABORATORY - Penn State coreendocrinelaboratorypennstate https://open.clemson.edu/arv_theses/3248/ "Ovarian Morphology and Endocrine Activity During the Postpartum Interv" by Marcy Anne Dimmick By Marcy Anne Dimmick, Published on 05/01/90 https://iris.cnr.it/handle/20.500.14243/181436 The ontogeny of the endocrine pancreas in the fetal/newborn baboon endocrine pancreasontogenyfetalnewbornbaboon https://pubmed.ncbi.nlm.nih.gov/11820622/ Estrogen receptor based in vitro assays for the evaluation of endocrine disrupters An increasing number of environmental chemicals is suspected to act similarly as endogenous estrogens at concentrations far below the so called "No Observed... in vitro assaysestrogen receptor https://publikationen.bibliothek.kit.edu/17799 Amphibians as model to study endocrine disruptors. II. Estroge... to studyendocrine disruptorsamphibiansmodelii https://shop.elsevier.com/books/subjects/health/medicine/surgery/endocrine-surgery Endocrine surgery print books and ebooks | Elsevier | Elsevier Shop Explore Elsevier's Endocrine surgery print books and ebooks, and stay up-to-date with the latest research and insights from top authors in the field. Find your... books and ebooksendocrine surgeryprintelseviershop https://declinic.com.au/ Endocrine, Diabetes and Metabolic Health Specialists Kotara Newcastle NSW metabolic healthendocrinediabetesspecialistskotara https://research.rug.nl/nl/datasets/data-from-do-immunological-endocrine-and-metabolic-traits-fall-on/ Data from: Do immunological, endocrine and metabolic traits fall on a single Pace-of-Life axis?... https://www.scirp.org/journal/PaperInformation?paperID=87146&fbclid=IwAR1V5r_Z23KAU4RlFZLgcqdPeNrtH7nPeDo21uvjfjhsOYjchlKzRMkJa14 Effect of 528 Hz Music on the Endocrine System and Autonomic Nervous System This study examined the stress-reducing effect on the endocrine system and the autonomic nervous system of music with a frequency of 528 Hz, which has recently... the endocrine systemmusic on https://www.mayoclinic.org/diseases-conditions/men-2/doctors-departments/ddc-20540517?filterLocation=Minnesota&lastInitial=K&page=1 Multiple endocrine neoplasia, type 2 (MEN 2) - Doctors and departments - Mayo Clinic Learn about this rare disorder that causes tumors and overproduction of hormones. multiple endocrine neoplasiatype https://pubmed.ncbi.nlm.nih.gov/37313312/ Human Transplant Kidneys on Normothermic Machine Perfusion Display Endocrine Activity Human transplant kidneys display endocrine activity during NMP. To explore whether correlations exist between hormone release rates and posttransplant kidney... humantransplantkidneysmachineperfusion https://op.europa.eu/en/web/public-procurement/procurement-details/-/procurement/080c4db5-9638-484d-83ec-3128e8a8fa3b Competition for the provision of health services in the field of Endocrine Clinic, Adult Allergy... https://www.myhormonedoc.com/ Endocrine & Diabetes Specialists in Rochester Hills, Michigan Expert endocrinologists specializing in diabetes, thyroid, weight, adrenal, pituitary (and other) hormone disorders. Located in Rochester Hills, MI. specialists inrochester hillsendocrinediabetesmichigan https://staging.seer.cancer.gov/eod_public/schema/3.1/endocrine_other/?breadcrumbs=(~schema_list~),(~view_schema~,~endocrine_other~),(~view_table~,~nodes_dcd~,~EOD_Regional_Nodes~) Endocrine Other | EOD Data SEER*RSA Your site description. endocrineeoddataseerrsa https://boris-portal.unibe.ch/entities/publication/fffbc14b-c90f-45aa-bd67-98d50d6b9df6 Cow-calf relationships of endocrine and metabolic parameters immediately after parturition. In addition to the metabolic and health status of cows at parturition, intrauterine conditions, the calving process, and colostrum feeding may affect endocrine... cow calfrelationshipsendocrine https://scholars.cityu.edu.hk/en/publications/hypoxia-induced-endocrine-disruption-and-impairment-of-reproducti/ Hypoxia-induced endocrine disruption and impairment of reproductive functions: In vivo and in vitro... endocrine disruption https://bionotes-liard.vercel.app/docs/Class-11/Endocrine_Case_Study/ Endocrine System - Case Studies - BioNotes May 1, 2026 - Note on Endocrine System - Case Studies for Major Diseases endocrine systemcase studiesbionotes https://pubmed.ncbi.nlm.nih.gov/30297439/ Long term adjuvant endocrine therapy and risk of cardiovascular disease in female breast cancer... Prospero CRD42017065944. https://endocrineallergy.com/ Endocrine laboratory and research institute ! Endocrine Allergy laboratory and researchendocrineinstituteallergy https://rutland-vt.increasingtestosterone.net/ Hormone specialist Rutland , VT - Endocrine Solutions hormone specialistrutland vtendocrinesolutions https://ja.dh.duke.edu/endocrine-case-conference-2020/content/endocrine-case-conference-2020-30 Endocrine Case Conference 2020 | DUKEHealth JA case conferenceendocrineja