https://www.discoverwildlife.com/news/two-new-flamboyant-stick-insect-species-discovered
Two new flamboyant stick insect species discovered - Discover Wildlife
May 11, 2022 - German scientists have discovered two new species of giant stick insect in the dry forest of the northern tip of Madagascar.
two newstick insectflamboyantspeciesdiscovered
https://www.frontiersin.org/journals/insect-science/articles/10.3389/finsc.2021.650520/full
Frontiers | Invasive Insect Species: Global Challenges, Strategies & Opportunities
Alien arthropods threaten human health, jeopardize food supplies, endanger valued species, risk economic losses, and disrupt ecosystem functions, at least so...
insect speciesglobal challengesfrontiersinvasivestrategies
https://www.cbs.com/shows/video/jqGASmtQAEAbHhKViGO9AxlgQgC5nuGC/
Watch CBS Saturday Morning: Insect species at risk - Full show on CBS
Insects are responsible for pollinating three quarters of global crops and forming the backbone of the food chain. But scientists estimate that about 40% of...
cbs saturday morninginsect speciesfull showwatch
https://www.engadget.com/2012-08-13-new-lacewing-species-found-on-flickr.html
Armchair Darwinians discover new insect species on Flickr
Aug 13, 2012 - Entomologist Shaun Winterton has discovered a new species of Malaysian Lacewing from the comfort of his computer. Idly browsing Flickr, he came across Guek...
discover newinsect speciesarmchairdarwiniansflickr
https://canalrivertrust.org.uk/things-to-do/canal-and-river-wildlife/a-spotters-guide-to-waterway-wildlife/mayfly
Mayfly insect species | Canal wildlife
Seen between May and August, the mayfly dances along the surface of our canals and rivers in search of a mate.
insect speciesmayflycanalwildlife
https://elifesciences.org/articles/96738
Regulatory genome annotation of 33 insect species | eLife
Over 2.8 million tissue-specific gene regulatory sequences are predicted for 33 insect genomes, using a simple computational workflow with only the genome...
genome annotationinsect speciesregulatory33elife
https://www.fwi.co.uk/news/insect-species-hit-by-habitat-loss
Insect species hit by habitat loss - Farmers Weekly
Aug 9, 2000 - 9 August 2000 Insect species hit by habitat loss By FWi staff CHANGING land use over the past century species has led to the loss of one in five species
insect speciesby habitathitlossfarmers
https://www.livescience.com/46058-new-stick-insect-species-discovered.html
New Stick Insect Species Discovered in China | Live Science
Jun 3, 2014 - Scientists discovered a new stick insect species in Guangxi, China.
stick insectchina livenewspeciesdiscovered
https://elifesciences.org/articles/53985
The head direction circuit of two insect species | eLife
Two evolutionary distant insect species share a common head direction circuit with subtle differences in neuronal morphologies that result in distinct circuit...
the headinsect speciesdirectioncircuittwo
https://loudwire.com/new-insect-species-names-nightwish-tuomas-holopainen/
New Insect Species Named After Nightwish's Tuomas Holopainen
A Finnish conservation biologist has named a new insect species after Nightwish keyboardist Tuomas Holopainen.
insect speciesnamed afternewnightwishtuomas
https://www.livescience.com/10252-insect-scourge-species-invade-year.html
Insect Scourge: Two New Species Invade U.S. Every Year | Live Science
Nov 5, 2010 - Two new insect pests settle in the U.S. each year
two new
https://ojp.gov/ncjrs/virtual-library/abstracts/species-identification-necrophagous-insect-eggs-based-amino-acid
Species Identification of Necrophagous Insect Eggs Based on Amino Acid Profile Differences Revealed...
https://www.wionews.com/science/this-invasive-insect-species-could-kill-126-million-trees-in-the-us-by-2050-463864
This invasive insect species could kill 1.26 million trees in the US by 2050 - Science News
https://www.mapress.com/zt/article/view/zootaxa.4979.1.26/44107
View of pstrongPapers and New Species of Minor Insect Orders Published in emZootaxa/em,...
https://www.sciencedaily.com/releases/2011/09/110908124620.htm
Chinese researchers identify insect host species of a famous Tibetan medicinal fungus | ScienceDaily
Based on an extensive survey of the literature pertaining to the Chinese caterpillar fungus, a fungus with high medicinal and economic values, researchers...
https://www.breitbart.com/politics/2018/05/20/climate-alarmists-50-percent-of-insect-species-to-lose-half-their-habitat-by-2100/
Climate Alarmists: 50 Percent of Insect Species to Lose Half Their Habitat by 2100
May 23, 2018 - Half of all insect species are on track to lose more than half their geographical range by the year 2100 thanks to global warming, a new study claims.
https://www.epidemicsound.com/sound-effects/tracks/a67876b9-bc20-4f7f-994b-1b35ad10c374/
SFX - Ambience, Tropical, Unknown Species Gaggle, Roar, Heavy Insect Background, Close High |...
Listen and use the track Ambience, Tropical, Unknown Species Gaggle, Roar, Heavy Insect Background, Close High. Sign up here!
https://www.gov.uk/research-for-development-outputs/assessing-the-threat-posed-to-forest-and-horticultural-plants-by-invasive-insect-species-in-northern-areas-of-pakistan-a-field-survey-of-mealy-bug-outbreak-in-baltistan
Assessing the threat posed to forest and horticultural plants by invasive insect species in...
https://www.mapress.com/jib/article/view/2023.42.2.2
New data on alien aphid species from Pakistan (Hemiptera: Aphididae) | Journal of Insect...
https://elifesciences.org/articles/53985v1/figures
Figures and data in The head direction circuit of two insect species | eLife
figures and datain the head
https://www.mapress.com/zt/article/view/zootaxa.4551.5.6
A new species of Rhinoleucophenga (Diptera: Drosophilidae), parasite of the scale insect pest...
a new
https://www.devdiscourse.com/article/science-environment/3883516-third-of-key-insect-species-recorded-in-western-ghats-feared-lost-study
Third of key insect species recorded in Western Ghats feared lost: Study | Science-Environment
Researchers have documented a nearly 35 per cent shortfall in dragonfly and damselfly species historically recorded in the Western Ghats, raising concerns over...
https://www.sciencefocus.com/news/tiny-beetle-is-the-first-ever-new-insect-species-to-be-discovered-in-fossilised-poo
Tiny beetle is the first-ever new insect species to be discovered in fossilised poo - BBC Science...
Jun 30, 2021 - The beetles were found in a lump of coprolite that was produced by an ancient dinosaur ancestor.
https://elifesciences.org/reviewed-preprints/87928v1/figures
Whole-genomes from the extinct Xerces Blue butterfly can help identify declining insect species
https://www.vecteezy.com/png/26552132-leaf-cutter-megachile-species-leaf-cutter-bee-insect-a-fluffy-brown-female-willughby-s-leaf-cutter-bee-megachile-willughbiella-transparent-background-png
leaf cutter, Megachile Species Leaf cutter Bee Insect, a fluffy brown female Willughby's...
Download the leaf cutter, Megachile Species Leaf cutter Bee Insect, a fluffy brown female Willughby's leaf-cutter bee, megachile willughbiella, transparent...
leaf cutter
https://mapress.com/zt/article/view/zootaxa.5647.2.3
Two new ant-attended species of the soft scale insect genus Coccus L. (Hemiptera: Coccomorpha:...
https://www.ecowatch.com/urban-greenspace-projects-insect-species.html
Small Urban Greening Projects Can Greatly Increase Insect Species Numbers in Cities - EcoWatch
Aug 28, 2023 - A new project by researchers from the University of Melbourne has found a way to increase insect species numbers in a small urban greenspace.
https://truthout.org/articles/climate-destabilization-causing-thousands-of-new-species-migrations-plant-animal-insect-bird/
Climate Destabilization Is Causing Thousands of New Species Migrations: Plant, Animal, Insect, Bird...
Jun 26, 2017 - A spate of new research studies has confirmed a disturbing pattern.
https://www.csiro.au/en/news/All/Articles/2020/July/this-ai-powered-platform-is-a-shazam-for-insect-and-snake-identification
This AI-powered platform can identify insect and snake species from photo - CSIRO
Dubbed Critterpedia, the platform will enable the user to take a photo of a snake or spider from any smart device before a trained algorithmic system...
https://elifesciences.org/reviewed-preprints/87928v1
Whole-genomes from the extinct Xerces Blue butterfly can help identify declining insect species
https://www.uwyo.edu/news/2022/10/uw-research-shows-insect-pollination-key-for-rare-wyoming-sagebrush-species.html
UW Research Shows Insect Pollination Key for Rare Wyoming Sagebrush Species
research showsinsect pollinationwyoming sagebrushuw
https://www.kobe-u.ac.jp/en/news/article/2020_08_04_01/
An insect species can actively escape from the vents of predators via the digestive system | Kobe...
Prey can evade predators and also avoid attacks. However, some can escape after a successful attack,...
https://www.commondreams.org/views/2020/09/04/world-honey-bee-day-another-reminder-40-insect-species-now-threatened-extinction
Opinion | World Honey Bee Day-Another Reminder that 40% of Insect Species Now Threatened With...
Jul 17, 2024 - Researchers need our help to advocate for policies that will protect insect populations.
world honey bee day
https://laughingsquid.com/black-beauty-stick-insect/
A Lovely Black Beauty Stick Insect Whose Species Could Become Extinct Without Captive Breeding
Feb 19, 2021 - Great Big Story profiled the very rare, recently discovered black beauty stick insect. Despite having specific defenses, their numbers are dwindling due
https://elifesciences.org/articles/96738/figures
Figures and data in Regulatory genome annotation of 33 insect species | eLife
Over 2.8 million tissue-specific gene regulatory sequences are predicted for 33 insect genomes, using a simple computational workflow with only the genome...
figures and datagenome annotation
https://www.indy100.com/viral/genitals-under-the-microscope-seven-new-species-of-frog-like-insect-discovered
Genitals under the microscope: seven new species of frog-like insect discovered | indy100
Nov 13, 2025 - The leafhoppers were discovered during fieldwork in Uganda.
under the microscope
https://www.nationalgeographic.com/animals/article/venus-flytrap-pollen-eat-insects-north-carolina-bog-spd
Venus Flytraps in North Carolina Are Pollinated By Three Insect Species | National Geographic
Researchers have identified which species are responsible for pollinating the carnivorous plants, but it's unclear why the plants don't eat them.
https://www.uvm.edu/femc/CI4/data/archive/project/insect-diversity-mount-mansfield-light-traps/dataset/insect-diversity-mount-mansfield-moth-species
FEMC - Dataset - Insect Diversity on Mount Mansfield: Moth Species Codes - Overview
Taxonomic codes and names of moth species collected in this study.
mount mansfieldfemcdatasetinsectdiversity