https://oife.org/
OIFE - Osteogenesis Imperfecta Federation Europe
Apr 3, 2026 - Osteogenesis Imperfecta Federation Europe (OIFE) is an umbrella association for organizations dealing with the rare disease Osteogenesis Imperfecta (OI).
osteogenesis imperfectafederationeurope
https://oif.org/
The Osteogenesis Imperfecta Foundation | Research, Education, Awareness, Support
Mar 18, 2026 - Discover the OI Foundation's mission to support those with osteogenesis imperfecta through education, research, and community engagement.
osteogenesis imperfectafoundation researcheducation awarenesssupport
https://disorders.eyes.arizona.edu/disorders/osteogenesis-imperfecta-type-vii
Osteogenesis Imperfecta, Type VII | Hereditary Ocular Diseases
osteogenesis imperfectatype viihereditaryoculardiseases
https://pubmed.ncbi.nlm.nih.gov/25736501/
Osteogenesis on nanoparticulate mineralized collagen scaffolds via autogenous activation of the...
Skeletal regenerative medicine frequently incorporates deliverable growth factors to stimulate osteogenesis. However, the cost and side effects secondary to...
osteogenesismineralizedcollagen
https://kidshealth.org/RadyChildrens/en/parents/osteogenesis-imperfecta.html
Osteogenesis Imperfecta (Brittle Bone Disease) (for Parents) - Rady Children's Hospital - San Diego
Osteogenesis imperfecta (or brittle bone disease) prevents the body from building strong bones. People with OI have bones that might break easily.
brittle bone disease
https://udspace.udel.edu/items/e231ffea-8232-4889-bc99-dce1865bbb3c
Osteogenesis and adipogenesis control in the BMP signaling pathway
According to NIH around 50% of women over age 50 are affected by Osteoporosis increasing the risk of fractures and injuries. Osteoporotic conditions may arise...
in theosteogenesisadipogenesiscontrolbmp
https://about.uq.edu.au/experts/project/34138
Nano-Engineered Titanium Dental Implants for Enhanced Osteogenesis | Project | UQ Experts
titanium dental implantsnanoengineered
https://pure.psu.edu/en/publications/bilateral-asynchronous-displaced-olecranon-fractures-in-a-patient/
Bilateral Asynchronous Displaced Olecranon Fractures in a Patient With Osteogenesis Imperfecta -...
olecranon fracturesbilateralasynchronousdisplaced
https://scholars.lib.ntu.edu.tw/entities/project/8529060f-191e-4c5d-8998-87f3d20a964d
Promotion of Peri-Implant Osteogenesis and Osseointegration by Functional Modification of...
by functionalpromotionperiimplantosteogenesis
https://tobias-lib.uni-tuebingen.de/xmlui/handle/10900/140502?show=full
How osteogenic is dexamethasone?-effect of the corticosteroid on the osteogenesis, extracellular...
of thedexamethasoneeffect
https://tagteam.harvard.edu/hub_feeds/3661/feed_items/3386679
TagTeam :: Osteogenesis imperfecta in 140 Turkish families: Molecular spectrum and, comparison of...
osteogenesis imperfecta
https://news.medill.northwestern.edu/chicago/tag/osteogenesis-imperfecta/
Osteogenesis Imperfecta Archives - Medill Reports Chicago
osteogenesis imperfectaarchivesreportschicago
https://research.vu.nl/en/publications/dental-abnormalities-in-osteogenesis-imperfecta-a-systematic-revi/
Dental Abnormalities in Osteogenesis Imperfecta: A Systematic Review - Vrije Universiteit Amsterdam
osteogenesis imperfectasystematic reviewvrije universiteitdentalabnormalities
https://pubmed.ncbi.nlm.nih.gov/22451222/
Recent advances in osteogenesis imperfecta
"Osteogenesis imperfecta" is a term used to describe a group of genetic disorders of variable phenotype usually defined by recurrent fractures, low bone mass,...
recent advancesosteogenesisimperfecta
https://cordis.europa.eu/project/id/275433/results/it
Determining novel peptide sequence and matrix mechanical properties to increase osteogenesis in...
Deliverables, publications, datasets, software, exploitable results
https://portal.fis.tum.de/en/publications/cardiopulmonary-dysfunction-in-the-osteogenesis-imperfecta-mouse-/
Cardiopulmonary dysfunction in the osteogenesis imperfecta mouse model Aga2 and human patients are...
https://tvmdl.tamu.edu/case-studies/osteogenesis-and-dentinogenesis-imperfecta-in-a-calf/
Osteogenesis and dentinogenesis imperfecta in a calf - Texas A&M Veterinary Medical Diagnostic...
Aug 29, 2024 - A 21 day-old calf with a history of multiple leg fractures and no evidence of external injuries was euthanized and sent into the TVMDL for evaluation of the...
in a
https://scholars.cityu.edu.hk/en/publications/osteogenesis-imperfecta-in-two-finnish-lapphund-puppies/
Osteogenesis Imperfecta in Two Finnish Lapphund Puppies - CityUHK Scholars
osteogenesis imperfectafinnish lapphundtwopuppiesscholars
https://www.semanticscholar.org/topic/OSTEOGENESIS-IMPERFECTA%2C-TYPE-IX-%28disorder%29/4627407
OSTEOGENESIS IMPERFECTA, TYPE IX (disorder) | Semantic Scholar
osteogenesis imperfectatype ixdisordersemanticscholar
https://pubmed.ncbi.nlm.nih.gov/32797291/
Osteogenesis imperfecta-pathophysiology and therapeutic options
Osteogenesis imperfecta (OI) is a rare congenital disease with a wide spectrum of severity characterized by skeletal deformity and increased bone fragility as...
osteogenesis imperfectapathophysiologytherapeuticoptions
https://www.frontiersin.org/journals/cell-and-developmental-biology/articles/10.3389/fcell.2023.1213641/full
Frontiers | CCL2 promotes osteogenesis by facilitating macrophage migration during acute...
Novel minimally invasive strategies are needed to obtain robust bone healing in complex fractures and bone defects in the elderly population. Local cell ther...
frontierspromotesosteogenesisfacilitatingmacrophage
https://research.vu.nl/en/publications/mir155-regulates-osteogenesis-and-bone-mass-phenotype-via-targeti/
Mir155 regulates osteogenesis and bone mass phenotype via targeting S1pr1 gene - Vrije Universiteit...
https://oi-gesellschaft.de/
Deutsche Gesellschaft für Osteogenesis imperfecta (Glasknochen) Betroffene e.V. – Deutsche...
… ist eine seltene angeborene Bindegewebsstörung. Sie kann sich auf viele unterschiedliche Weisen bemerkbar machen. Eine extrem hohe Knochenbrüchigkeit ist das...
osteogenesis imperfectadeutschegesellschaftglasknochenbetroffene
https://www.nichd.nih.gov/health/topics/osteogenesisimp/conditioninfo/symptoms
What are the symptoms of osteogenesis imperfecta (OI)? | NICHD - Eunice Kennedy Shriver National...
All types of OI have some degree of bone fragility and fracturing, and many have some degree of bone deformity.
what are the symptoms
https://repository.gatech.edu/entities/publication/3e03c6a6-17be-4bd4-9063-8c4edf338a0e
Induced Pluripotent Stem Cell-based in vitro Modeling of the Osteogenesis and Chondrogenesis of...
The application of pluripotent stem-cell based in vitro models has become increasingly popular in medical research, especially for situations in which animal...
in vitro modeling
https://dspace.rpi.edu/items/75525c0a-b83d-4b8e-a499-6fb51fe512a6
The effects of biophysical stimuli on select bone cell functions pertinent to osteogenesis
Although electric, pulsed electromagnetic, and magnetic fields have been used in attempts to accelerate bone repair in animal models and in clinical studies,...
https://www.glasknochen.ch/
Willkommensseite - Schweizerische Vereinigung Osteogenesis Imperfecta
Jun 19, 2026 - Symposiums-Programm als PDF herunterladen Video auf
schweizerischevereinigungosteogenesisimperfecta
https://pubmed.ncbi.nlm.nih.gov/40118264/
Klotho senses mechanical stimuli and modulates tension-induced osteogenesis
Delicate external mechanosensing, efficient intracellular mechanotransduction and effective alveolar bone remodeling lay the foundation of orthodontic tooth...
klothosensesmechanicalstimulitension
https://rarediseases.info.nih.gov/diseases/8696/osteogenesis-imperfecta-with-normal-sclerae-dominant-form
Osteogenesis imperfecta with normal sclerae, dominant form | About the Disease | GARD
Find symptoms and other information about Osteogenesis imperfecta with normal sclerae, dominant form.
about the diseaseosteogenesis imperfectanormal
https://tagteam.harvard.edu/hub_feeds/3661/feed_items/12124897
TagTeam :: Exome sequencing identified mutations in the WNT1 and COL1A2 genes in osteogenesis...
exome sequencing
https://pubmed.ncbi.nlm.nih.gov/41874753/
Bioglass nanofibers in a 3D scaffold orchestrate robust bone regeneration via enhanced osteogenesis...
The main aim of the present study is to fabricate a 3D scaffold loaded with bioglass nanofibers to orchestrate robust bone regeneration via enhanced...
https://disorders.eyes.arizona.edu/references/low-ocular-rigidity-patients-osteogenesis-imperfecta
Low ocular rigidity in patients with osteogenesis imperfecta | Hereditary Ocular Diseases
in patientsosteogenesis imperfectalowocularrigidity
https://researchfestival.nih.gov/2024/posters/fetal-breathing-deficiency-and-lung-hypoplasia-osteogenesis-imperfecta
Fetal breathing deficiency and lung hypoplasia in osteogenesis imperfecta | NIH Research Festival
https://pubmed.ncbi.nlm.nih.gov/31447884/
COL1A1/2 Pathogenic Variants and Phenotype Characteristics in Ukrainian Osteogenesis Imperfecta...
Osteogenesis imperfecta (OI) is a hereditary bone disorder caused by defects of type I collagen. Although up to 90% of patients harbor pathogenic variants in...
in ukrainianpathogenicvariants
https://pubmed.ncbi.nlm.nih.gov/7285446/
Osteogenesis imperfecta: an expanding panorama of variants
Our concept of osteogenesis imperfecta (OI) has expanded considerably in the last decade. Both clinical and genetic studies on the one hand and biochemical...
osteogenesis imperfectaexpandingpanoramavariants
https://pmc.ncbi.nlm.nih.gov/articles/PMC10860322/
Bleeding assessment in a large cohort of patients with Osteogenesis Imperfecta - PMC
Osteogenesis Imperfecta (OI) is characterised by bone fragility. Among several features, easy bruising and multiple case reports on haemorrhagic events have...
in a
https://pmc.ncbi.nlm.nih.gov/articles/PMC151622/
Modeling the benefits of pamidronate in children with osteogenesis imperfecta - PMC
the benefitsin childrenosteogenesis imperfectamodeling
https://medicine.iu.edu/research-centers/musculoskeletal/patient-advocacy/osteogenesis-imperfecta
Osteogenesis Imperfecta Federation Europe | Patient Advocacy | Indiana Center for Musculoskeletal...
osteogenesis imperfectapatient advocacycenter forfederationeurope
https://pure.psu.edu/en/publications/successful-operative-rib-fixation-of-traumatic-flail-chest-in-a-p/
Successful operative rib fixation of traumatic flail chest in a patient with osteogenesis...
https://hsrc.himmelfarb.gwu.edu/smhs_rad_facpubs/514/
"Popcorn Calcification in Osteogenesis Imperfecta: Incidence, Progressi" by A. A. Obafemi, D. I....
By A. A. Obafemi, D. I. Bulas, J. Troendle, et al., Published on 01/01/08
osteogenesis imperfecta
https://pure.psu.edu/en/publications/angiogenesis-and-intramembranous-osteogenesis/
Angiogenesis and intramembranous osteogenesis - Penn State
angiogenesisosteogenesispennstate
https://disorders.eyes.arizona.edu/references/natural-history-blue-sclerae-osteogenesis-imperfecta
Natural history of blue sclerae in osteogenesis imperfecta | Hereditary Ocular Diseases
natural historyosteogenesis imperfectablue
https://pubmed.ncbi.nlm.nih.gov/10969267/
Osteogenesis imperfecta in childhood: prognosis for walking
The type of OI is the single most important clinical indicator of the ultimate ability to walk. Information about motor development adds little. The early...
osteogenesis imperfectachildhoodprognosiswalking
https://prism.northwestern.edu/records/k7n5h-8n875
Hydrocephalus in Osteogenesis Imperfecta
hydrocephalusosteogenesisimperfecta
https://rarediseases.info.nih.gov/diseases/17156/ehlers-danlososteogenesis-imperfecta-syndrome
Ehlers-Danlos/osteogenesis imperfecta syndrome | About the Disease | GARD
Find symptoms and other information about Ehlers-Danlos/osteogenesis imperfecta syndrome.
about the diseaseehlers danlososteogenesis imperfectasyndromegard
https://oifn.org/
Osteogenesis Imperfecta Foundation Network [OIFN]
osteogenesis imperfectafoundationnetwork
https://kidshealth.org/HumanaLouisiana/en/parents/osteogenesis-imperfecta.html
Osteogenesis Imperfecta (Brittle Bone Disease) (for Parents) - Humana - Louisiana
Osteogenesis imperfecta (or brittle bone disease) prevents the body from building strong bones. People with OI have bones that might break easily.
brittle bone diseaseosteogenesis imperfectafor parentshumanalouisiana
https://www.nichd.nih.gov/health/topics/osteogenesisimp/conditioninfo/diagnose
How do healthcare providers diagnose osteogenesis imperfecta (OI)? | NICHD - Eunice Kennedy Shriver...
If OI is moderate or severe, healthcare providers usually diagnose it during prenatal ultrasound. If OI is milder, parents or healthcare providers may notice...
how dohealthcare providersosteogenesis imperfecta
https://disorders.eyes.arizona.edu/category/alternate-names/ocular-osteogenesis-imperfecta
ocular osteogenesis imperfecta | Hereditary Ocular Diseases
osteogenesis imperfectaocularhereditarydiseases
https://scholarworks.indianapolis.iu.edu/items/86195b33-326b-4ab6-9673-df89113546b6
6820 Assessing The Efficacy And Safety Of Setrusumab For Osteogenesis Imperfecta: Updated Phase 2...
Osteogenesis imperfecta (OI) is a rare genetic disorder characterized by bone fragility and low bone mass with no universally accepted treatment. Setrusumab is...
https://pubmed.ncbi.nlm.nih.gov/38477793/
Impaired muscle parameters in adults with mild to severe types of osteogenesis imperfecta: a...
Impaired muscle parameters may further compromise the already compromised skeleton in individuals with OI. This cross-sectional study aimed to compare muscle...
https://data.mendeley.com/datasets/4vnv6dpnwn/1
A study of Akt2 Regulates Autophagy and Osteogenesis in Diabetic Osteoporosis via PI3K/AKT/mTOR...
Original images of western blot in this paper.
https://www.michigan.gov/whitmer/news/proclamations/2022/04/30/april-30---may-1-2022-osteogenesis-imperfecta-awareness-week
April 30 - May 1, 2022: Osteogenesis Imperfecta Awareness Week
osteogenesis imperfectaaprilmayawarenessweek
https://scholars.cityu.edu.hk/en/publications/osteogenesis-catalyzed-by-titanium-supported-silver-nanoparticles/
Osteogenesis Catalyzed by Titanium-Supported Silver Nanoparticles - CityUHK Scholars
silver nanoparticlesosteogenesistitaniumsupportedscholars
https://rarediseases.info.nih.gov/diseases/8701/osteogenesis-imperfecta-type-7
Osteogenesis imperfecta type 7 | About the Disease | GARD
Find symptoms and other information about Osteogenesis imperfecta type 7.
about the diseaseosteogenesis imperfectatypegard
https://www.cms.gov/medicare-coverage-database/view/article.aspx?articleid=52513&ver=37&handler=CreatePdf
Article - Osteogenesis Stimulators - Policy Article (A52513)
Use this page to view details for the Local Coverage Article for Osteogenesis Stimulators - Policy Article.
articleosteogenesisstimulatorspolicy
https://publica.fraunhofer.de/entities/publication/51db5e35-e35c-48b0-81cd-cd119198e3ee
Surface activation with oxygen plasma promotes osteogenesis with enhanced extracellular matrix...
Various types of synthetic polyesters have been developed as biomaterials for tissue engineering. These materials commonly possess biodegradability,...
surface activationoxygenplasmapromotesosteogenesis
https://ya-boginhall-7.b-cdn.net/how-massage-can-help-with-osteogenesis-imperfecta.html
How Massage Can Help with Osteogenesis Imperfecta
can help withmassageosteogenesisimperfecta
https://pure.psu.edu/en/publications/gene-therapy-approaches-for-osteogenesis-imperfecta/
Gene therapy approaches for osteogenesis imperfecta - Penn State
gene therapyosteogenesis imperfectaapproachespennstate
https://gpe.wikipedia.org/wiki/Category:People_plus_osteogenesis_imperfecta
Category:People plus osteogenesis imperfecta - Wikipedia
people plusosteogenesis imperfectacategorywikipedia
https://tagteam.harvard.edu/hub_feeds/3661/feed_items/9112331/content
TagTeam :: Assessing type I collagen expression and quality in cellular models of osteogenesis...
https://pubmed.ncbi.nlm.nih.gov/27495102/
Osteogenesis imperfecta and clubfoot-a rare combination: Case report and review of the literature
In the presence of an orthopedic pathology associated with OI, it is recommended to manage the patient according to the underlying pathology, always...
https://seputarmetro.com/mengenal-osteogenesis-imperfecta-hidup-dengan-tulang-rapuh/
Osteogenesis Imperfecta: Hidup dengan Tulang Rapuh
Jun 29, 2025 - Mengenal Osteogenesis Imperfecta: Hidup dengan Tulang Rapuh Osteogenesis Imperfecta (Penyakit Tulang Rapuh): Tulang
osteogenesis imperfectahidupdengantulang