Robuta

https://library.perfusioneducation.com/ Perfusion Education and ABCP CEU Made Easy and Affordable PerfusionEducation.com is a site where perfusion professionals can earn ABCP SCDE Category 1 CEU. Earn CEU through us for all your ABCP Perfusion requirements made easyperfusioneducationabcpceu https://bridgetolife.com/ Organ Preservation & Perfusion Solutions | Organ Transplantation Technology Jun 1, 2026 - You know Bridge to Life for our unwavering commitment to quality and service. But we’re more than that. We’re focusing beyond product needs to be a true... organ preservationperfusionsolutionstransplantationtechnology https://studiosante.fr/ STUDIOSANTÉ® - Votre expert en perfusion à domicile Aug 5, 2025 - La perfusion à domicile est une solution pratique et confortable aux patients nécessitant un traitement médical continu. votre expertenperfusiondomicile https://perfusionadomicile.fr/ La perfusion à domicile Feb 25, 2026 - La perfusion à domicile consiste à administrer chez le patient des médicaments par le biais d’injections lentes et continues ou discontinues. laperfusiondomicile https://publikationen.uni-tuebingen.de/xmlui/handle/10900/151462 Computed tomography perfusion imaging-guided intravenous thrombolysis in acute minor ischemic stroke computed tomography https://eprints.ncl.ac.uk/281529 Thrombectomy With and Without Computed Tomography Perfusion Imaging in the Early Time Window: A... https://portal.research.lu.se/en/publications/quantifying-coronary-sinus-flow-and-global-lv-perfusion-at-3t/fingerprints/ Quantifying coronary sinus flow and global LV perfusion at 3T - Fingerprint - Lund University https://tobias-lib.ub.uni-tuebingen.de/xmlui/handle/10900/41776 Is myocardial stress perfusion MR-imaging suitable to predict the long term clinical outcome after... https://experts.arizona.edu/en/publications/expired-psubcosub2subsub-as-an-index-of-coronary-perfusion-pressu/ Expired PCO2 as an index of coronary perfusion pressure - University of Arizona index ofexpired https://publications-cnrc.canada.ca/eng/view/object/?id=ab60dd07-2836-487d-9d76-c0b2742c2860 High-titer adenovirus vector production in 293s cell perfusion culture - NRC Publications Archive -... High-titer adenovirus vector production in 293s cell perfusion culture https://www.accessdata.fda.gov/scripts/cdrh/cfdocs/cfRes/res.cfm?id=107622 Class 2 Device Recall Terumo Advanced Perfusion System 1 perfusion systemclassdevicerecallterumo https://scholars.lib.ntu.edu.tw/entities/publication/adcc468a-e0bb-4944-b731-3da9bc4c4163 Discrepant MR spectroscopic and perfusion imaging results in a case of malignant transformation of... https://iris.cnr.it/handle/20.500.14243/337607 Mechanisms of ventilation-perfusion mismatch and hemodynamic alterations in acute and chronic... mechanismsventilationperfusionmismatch https://www.cms.gov/medicare-coverage-database/view/lcd.aspx?LCDId=38786 LCD - Echocardiography for Myocardial Perfusion (L38786) Use this page to view details for the Local Coverage Determination for Echocardiography for Myocardial Perfusion. lcdechocardiographyperfusion https://ub01.uni-tuebingen.de/xmlui/handle/10900/63249 Anatomic-Functional (Perfusion-Based) Magnetic Resonance Imaging Follow-up in Patients With... magnetic resonance imaging https://www.frontiersin.org/journals/bioengineering-and-biotechnology/articles/10.3389/fbioe.2022.958072/full Frontiers | Improvement of the bladder perfusion curative effect through tight junction protein... Postoperative intravesical instillation of chemotherapy is a routine procedure for non-muscular invasive bladder cancer (NMIBC). However, traditional bladder... of the https://pubmed.ncbi.nlm.nih.gov/8983267/?dopt=Abstract&holding=idemdclib_fft&otool=idemdclib Is isolated limb perfusion of metastatic malignant melanoma of the extremity worthwhile? Is isolated limb perfusion of metastatic malignant melanoma of the extremity worthwhile? malignant melanomaisolatedlimbperfusion https://cordis.europa.eu/project/id/804252/reporting/pl Normothermic Perfusion Device for Renal and Hepatic Preservation and Viability Assessment | H2020 |... Latest report summary perfusiondevicerenal https://pubmed.ncbi.nlm.nih.gov/2419392/ Fixation, fine structure, and immunostaining for neuropeptides: perfusion versus immersion of the... The effects of various fixatives and fixation methods on ultrastructural morphology and the immunocytochemical localization of beta-endorphin were examined in... fine structure https://app.perfusionlife.com/ Perfusion Life perfusionlife https://handbook.monash.edu/2026/units/cvp5001 CVP5001 - Anatomy and physiology for perfusion - Monash University This is the official site of the Monash University Handbook for course and unit information. anatomy and physiologyperfusionmonashuniversity https://research.utwente.nl/en/publications/signal-processing-for-a-laser-doppler-blood-perfusion-meter/ Signal processing for a laser-Doppler blood perfusion meter - University of Twente Research... https://repository.gatech.edu/entities/publication/b1e4cf31-f7d2-477d-ad79-c3715b5cfbe4 Foot Perfusion Measurements in Diabetic Patients with Pedal Ulcers Using Multimodal MRI Hyperglycemia, a hallmark of uncontrolled type-2 diabetes mellitus (T2DM), is associated with several microvascular complications such as calcification of... https://research.utwente.nl/en/publications/speckle-related-scaling-effects-in-laser-doppler-perfusion-imagin/ Speckle related scaling effects in laser Doppler perfusion imaging - University of Twente Research... https://profiles.wustl.edu/en/publications/increased-myocardial-perfusion-at-rest-and-diminished-perfusion-r/fingerprints/ Increased myocardial perfusion at rest and diminished perfusion reserve in patients with angina and... at rest https://surgery.duke.edu/news/out-body-experience-rejuvenating-organs-using-ex-vivo-perfusion Out of Body Experience: Rejuvenating Organs Using Ex Vivo Perfusion | Duke Department of Surgery Photo: Cardiothoracic surgeons Dr. Jacob Klapper and Dr. Nnamdi Nwaejike perform a double lung transplant. Shawn Rocco/Duke Health Each day, tens of thousands... out of body experience https://research.tudelft.nl/en/publications/imaging-ppg-for-in-vivo-human-tissue-perfusion-assessment-during-/ Imaging PPG for In Vivo Human Tissue Perfusion Assessment during Surgery - TU Delft Research Portal https://pubmed.ncbi.nlm.nih.gov/20381277/ Diffusion and perfusion imaging of bone marrow In diffusion-weighted magnetic resonance imaging (DWI), the observed MRI signal intensity is attenuated by the self-diffusion of water molecules. DWI provides... diffusionperfusionimagingbonemarrow https://portal.research.lu.se/en/publications/absolute-quantification-of-perfusion-by-dynamic-susceptibility-co/projects/?status=RUNNING Absolute quantification of perfusion by dynamic susceptibility contrast MRI using Bookend and VASO... https://clinicaltrials.med.nyu.edu/cancer/clinicaltrial/2235/rapid-motion-robust-easy-to-use-dynamic/?qd=39283453 Rapid Motion-Robust and Easy-to-Use Dynamic Contrast-Enhanced MRI for Liver Perfusion... New life-saving treatments for hepatocellular carcinom in clinical trial on Rapid Motion-Robust and Easy-to-Use Dynamic Contrast-Enhanced MRI for Liver... https://www.wolterskluwer.com/fr-be/solutions/ovid/mr---ct-perfusion-imaging--clinical-applications-and-theoretical-principles-13787 Ovid - MR & CT Perfusion Imaging: Clinical Applications and Theoretical Principles | Wolters Kluwer This is the first text of its kind to comprehensively address the technical and clinical aspects of perfusion imaging, used in both MRI and CT. ct perfusionclinical applications https://ibme.ox.ac.uk/publication/tissue-perfusion-diagnostic-classification-using-a-spatio-temporal-analysis-of-contrast-ultrasound-image-sequences/ Tissue perfusion diagnostic classification using a spatio-temporal analysis of contrast ultrasound... diagnostic classification https://researchdiscovery.drexel.edu/esploro/outputs/journalArticle/Perfusate-acidification-enhances-response-to-melphalan/991019231749204721 Perfusate acidification enhances response to melphalan isolated limb perfusion by a nitric oxide... Perfusate acidification enhances response to melphalan isolated limb perfusion by a nitric oxide mediated tumor specific reduction in blood flow - Drexel... https://scholarworks.indianapolis.iu.edu/items/297a7788-3e4a-4130-9674-139a72290709 Retrospective Detection and Suppression of Dark-Rim Artifacts in First-Pass Perfusion Cardiac MRI... The dark-rim artifact (DRA) remains an important challenge in the routine clinical use of first-pass perfusion (FPP) cardiac magnetic resonance imaging (cMRI).... https://scholars.duke.edu/publication/641765 Scholars@Duke publication: The perfusion of isolated whole organs. scholarsdukepublicationperfusionisolated https://www.wolterskluwer.com/en/solutions/ovid/perfusion-imaging-in-clinical-practice--a-multimodality-approach-to-tissue-perfusion-analysis-13756 Ovid - Perfusion Imaging in Clinical Practice: A Multimodality Approach to Tissue Perfusion... Here's the first comprehensive resource that encompasses every facet of this important and rapidly advancing area of diagnostic imaging. clinical practiceovidperfusionimaging https://digital.library.adelaide.edu.au/items/056d0da0-08fd-40b2-9764-5a1c4722bd69 Arginine Vasopressin improves cerebral perfusion following controlled haemorrhage in adult ewes Key points: Traumatic haemorrhagic shock carries significant morbidity and mortality related to the severity and duration of tissue hypoperfusion, much of... argininevasopressinimprovescerebralperfusion https://pure.psu.edu/en/publications/beneficial-effects-of-volume-expansion-and-nitroprusside-on-hemod/ Beneficial effects of volume expansion and nitroprusside on hemodynamics and organ perfusion in... https://www.photoacoustics.lu.se/malin-malmsjo/publication/917505bd-38a8-4a9f-89e0-5c7b684bac80 The effect of traction force on eyelid blood perfusion during closure of defects | Lund University... https://scholars.uky.edu/en/publications/magnetic-resonance-myocardial-perfusion-imaging-safety-and-indica/ Magnetic Resonance Myocardial Perfusion Imaging: Safety and Indications in Pediatrics and Young... magnetic resonanceperfusionimaging https://www.frontiersin.org/journals/bioengineering-and-biotechnology/articles/10.3389/fbioe.2025.1608889/full Frontiers | Cell specific perfusion rates drive growth dynamics and metabolism in CHO N-1 perfusion... The production of monoclonal antibodies (mAbs) using Chinese Hamster Ovary (CHO) cell host systems often faces challenges in terms of manufacturing costs and... https://www.events.scps.org.uk/ SCPS Events | Society of Clinical Perfusion Scientists The Society of Clinical Perfusion Scientists (SCPS) Events portal provides all the information you need for our upcoming AGMs and webinars. scpseventssocietyclinicalperfusion https://spiral.imperial.ac.uk/entities/publication/a49d3fae-856a-4259-8c40-94b75c870073 Machine perfusion for assessing and optimizing kidney and pancreas allografts Introduction: The predominate issue in transplantation today is the inadequate supply of suitable organs for an increasing number of patients on the transplant... machineperfusionassessingoptimizingkidney https://boris-portal.unibe.ch/entities/publication/dbc49485-d107-47a6-a73d-66f9ec66c479 Targeted Tissue Perfusion Versus Macrocirculatory-Guided Standard Care in Patients With Septic... Objectives To determine whether treatment targeting improving tissue perfusion while allowing lower than recommended blood pressure (targeted tissue perfusion... https://research.tue.nl/en/publications/cmr-2-65-quality-control-of-stress-perfusion-cmr-segmentations-wi/ CMR 2-65 - Quality-control of Stress Perfusion CMR Segmentations with Weakly Supervised... quality control https://pubmed.ncbi.nlm.nih.gov/37313312/ Human Transplant Kidneys on Normothermic Machine Perfusion Display Endocrine Activity Human transplant kidneys display endocrine activity during NMP. To explore whether correlations exist between hormone release rates and posttransplant kidney... humantransplantkidneysmachineperfusion https://handbook.monash.edu/2026/units/cvp5005 CVP5005 - Biochemistry and pharmacology for perfusion - Monash University This is the official site of the Monash University Handbook for course and unit information. biochemistrypharmacologyperfusionmonashuniversity https://researchdiscovery.drexel.edu/esploro/outputs/conferenceProceeding/Second-harmonic-Doppler-ultrasound-blood-perfusion/991019173747704721 Second harmonic Doppler ultrasound blood perfusion measurement - Drexel University In vivo testing of a recently introduced method of evaluating blood perfusion is presented, where the Doppler shift of the second harmonic component of the... doppler ultrasoundsecondharmonicbloodperfusion https://pmc.ncbi.nlm.nih.gov/articles/PMC9650151/ Potential mechanisms of acupuncture in enhancing cerebral perfusion of ischemic stroke - PMC Ischemic stroke is the predominant cause of long-term disability and death worldwide. It is attributable to the sudden interruption of regional cerebral blood... ischemic strokepotentialmechanismsacupuncture https://www.research.va.gov/about/funded_research/proj-details-FY2022.cfm?pid=735403 I21RX003857-01A1 - Spreading Depolarizations and Perfusion in Non-traumatic Spinal Cord Injury https://experts.arizona.edu/en/publications/spectpet-myocardial-perfusion-imaging-versus-coronary-ct-angiogra/ SPECT/PET myocardial perfusion imaging versus coronary CT angiography in patients with known or... https://www.frontiersin.org/journals/medicine/articles/10.3389/fmed.2020.00135/full Frontiers | A Systematic Review and Meta-Analysis of Machine Perfusion vs. Static Cold Storage of... Background: Machine perfusion (MP) and static cold storage (CS) are two prevalent methods for liver allograft preservation. However, the preferred method rem... https://iro.uiowa.edu/esploro/outputs/journalArticle/Regional-pulmonary-perfusion-blood-volume-and/9985141864702771?institution=01IOWA_INST&skipUsageReporting=true&recordUsage=false Regional pulmonary perfusion, blood volume, and their relationship change in experimental early... Mar 10, 2024 - Regional pulmonary perfusion (Q) has been investigated using blood volume (F ) imaging as an easier-to-measure surrogate. However, it is unclear if changing... https://researchconnect.buffalo.edu/en/publications/masked-smoothing-using-separable-kernels-for-ct-perfusion-images/ Masked smoothing using separable kernels for CT perfusion images - SUNY University at Buffalo https://ub01.uni-tuebingen.de/xmlui/handle/10900/65428?show=full Characterization of hepatocellular carcinoma (HCC) lesions using anovel CT-based volume perfusion... hepatocellular carcinoma https://pmc.ncbi.nlm.nih.gov/articles/PMC6813289/ EANM guideline for ventilation/perfusion single-photon emission computed tomography (SPECT) for... These guidelines update the previous EANM 2009 guidelines on the diagnosis of pulmonary embolism (PE). Relevant new aspects are related to (a) quantification... computed tomographyeanmguidelineventilationperfusion https://ibme.ox.ac.uk/publication/development-of-perfusion-based-micro-3-d-cell-culture-platform-and-its-application-for-high-throughput-drug-testing/ Development of perfusion-based micro 3-D cell culture platform and its application for high... https://groups.inf.ed.ac.uk/nesc-research/node/866.html Early detection of infarcts by improving brain perfusion imaging analysis | Edinburgh... early detection https://researchprofiles.ku.dk/en/publications/measurement-of-brain-perfusion-blood-volume-and-blood-brain-barri/ Measurement of brain perfusion, blood volume, and blood-brain barrier permeability, using dynamic... measurementbrainperfusionblood https://scholars.duke.edu/publication/735057 Scholars@Duke publication: Scintigraphic perfusion patterns in patients with diffuse lung disease. https://portal.fis.tum.de/en/publications/incubator-independent-cell-culture-perfusion-platform-for-continu/ Incubator-independent cell-culture perfusion platform for continuous long-term microelectrode array... cell culture https://refubium.fu-berlin.de/handle/fub188/52437 Refubium - Altered brain perfusion and oxygen levels relate to sleepiness and attention in... oxygen levels https://my01.io/ MY01 – Continuous Perfusion Sensing Technology continuousperfusionsensingtechnology https://www.mdpi.com/2306-5354/10/6/729 Infrared Thermography Imaging for Assessment of Peripheral Perfusion in Patients with Septic Shock Skin temperature changes can be used to assess peripheral perfusion in circulatory shock patients. However, research has been limited to point measurements... https://theses.gla.ac.uk/84509/ The use of pre-implantation perfusion techniques of kidney grafts to increase organ utilisation and... https://scholarshare.temple.edu/items/612b302f-1187-449a-bc59-1ec961dcca29 MACHINE LEARNING-BASED ARTERIAL SPIN LABELING PERFUSION MRI SIGNAL PROCESSING Arterial spin labeling (ASL) perfusion Magnetic Resonance Imaging (MRI) is a noninvasive technique for measuring quantitative cerebral blood flow (CBF) but... machine learningbasedarterialspinlabeling https://pubmed.ncbi.nlm.nih.gov/36306391/ Deep learning for myocardial ischemia auxiliary diagnosis using CZT SPECT myocardial perfusion... Our prototype system can considerably reduce the time required for image interpretation and improve the quality of medical care. It can assist clinical experts... deep learningmyocardial ischemia https://medicine.utah.edu/surgery/cardiothoracic/perfusion-studies/letter-from-the-director Letter From The Cardiovascular Perfusion Director | Surgery | U of U School of Medicine from thecardiovascular perfusionletter https://ecommerce.unimelb.edu.au/medical-perfusion-subject-1 Medical Perfusion Subject 1 Order course materials, books, academic statements, memberships, PPE, branded gifts and apparel. medical perfusionsubject https://cir.nii.ac.jp/crid/1040573407543039744 The development of high-speed MR perfusion weighted imaging for elucidating the pathophysiology of... the developmenthigh speed https://mau.diva-portal.org/smash/record.jsf?pid=diva2:1401275 Parametric quantification of myocardial ischaemia using real-time perfusion adenosine stress... real timeparametricquantification https://gzmaya.en.made-in-china.com/product/uTSUipdvkOWj/China-My-W081-Veterinary-Medical-Kidney-Hemodialysis-Machine-Price-Animal-Blood-Perfusion-Hemodialysis-System.html My-W081 Veterinary Medical Kidney Hemodialysis Machine Price Animal Blood Perfusion Hemodialysis... My-W081 Veterinary Medical Kidney Hemodialysis Machine Price Animal Blood Perfusion Hemodialysis System, Find Details and Price about Veterinary Hemodialysis... veterinary medicalhemodialysis machinekidney https://research.ibm.com/publications/extracting-visualizing-and-learning-from-dynamic-data-perfusion-in-surgical-video-for-tissue-characterization Extracting, Visualizing, and Learning from Dynamic Data: Perfusion in Surgical Video for Tissue... Extracting, Visualizing, and Learning from Dynamic Data: Perfusion in Surgical Video for Tissue Characterization for ICDH 2022 by Jonathan P. Epperlein et al. https://experts.mcmaster.ca/scholarly-works/1649590 Using Magnetic Resonance Perfusion to Stratify... Learn about the scholarly work entitled Using Magnetic Resonance Perfusion to Stratify... magnetic resonanceusingperfusionstratify https://digitalcommons.usf.edu/etd/823/ "Arterial Perfusion Detection Method By Synchronous Detection" by Yohan Prevot The pressure ulcer is a well-known clinical problem that has plagued many patients in acute-care hospitals and chronic-care facilities. The pressure ulcer has... arterialperfusiondetectionmethodsynchronous https://fujifilmbiosciences.fujifilm.com/us/resources/open-access-jones-mark-et-al-2020-a-comparison-of-automated-perfusion-and-manual-diffusion-based-human-regulatory-t-cell-expansion-and-functionality-using-a-soluble-activator-complex-cell-transplant.html OPEN ACCESS: Jones, Mark et.al. (2020) A Comparison of Automated Perfusion- and Manual... OPEN ACCESS: Jones, Mark et.al. (2020) A Comparison of Automated Perfusion- and Manual Diffusion-Based Human Regulatory T Cell Expansion and Functionality... https://pubmed.ncbi.nlm.nih.gov/8010828/ Retrograde cerebral perfusion via a superior vena caval cannula for aortic arch aneurysm operations A simplified technique for reversed cerebral perfusion during hypothermic circulatory arrest for transverse aortic arch repair is described. Substantial... https://ibme.ox.ac.uk/publication/comparison-of-perfusion-and-static-culture-system-on-metabolic-rate-and-matrix-production-by-bovine-articular-chondrocytes-in-agarose-gels/ Comparison of perfusion and static culture system on metabolic rate and matrix production by bovine... https://theses.gla.ac.uk/83269/ Multiscale modelling of perfusion and mechanics in poroelastic biological tissues - Enlighten Theses https://pubchem.ncbi.nlm.nih.gov/patent/US-2014227677-A1 Perfusion of prospective donor hearts with polymerized hemoglobin - Patent US-2014227677-A1 -... US-2014227677-A1 chemical patent summary. https://ibme.ox.ac.uk/publication/normothermic-perfusion-of-human-livers-for-profiling-lentiviral-vector-pharmacokinetics-and-transduction/ Normothermic Perfusion of Human Livers for Profiling Lentiviral Vector Pharmacokinetics and... lentiviral vectorperfusionhumanlivers https://nrc-publications.canada.ca/eng/view/object/?id=64898601-fb9f-468d-bb06-a9742462dfe3 Effect of pH management on brain perfusion during retrograde cerebral perfusion - NRC Publications... Effect of pH management on brain perfusion during retrograde cerebral perfusion ph management https://pubmed.ncbi.nlm.nih.gov/19562336/ EANM guidelines for ventilation/perfusion scintigraphy : Part 1. Pulmonary imaging with... Pulmonary embolism (PE) can only be diagnosed with imaging techniques, which in practice is performed using ventilation/perfusion scintigraphy (V/P(SCAN)) or... eanmguidelinesventilationperfusion https://pubmed.ncbi.nlm.nih.gov/37389552/ Normothermic Machine Perfusion of Donor Livers for Transplantation in the United States: A... NMP did not lower EAD, perhaps related to the inclusion of lower-risk liver donors, as higher-risk donor livers seemed to benefit more. The technology is safe... in the united states https://finance.duke.edu/gl_account/26200/ Salary Support - Perfusion | Finance Salary Support - Perfusion - Finance salarysupportperfusionfinance https://vtechworks.lib.vt.edu/items/243125db-52a9-435f-b7a1-fd815a01966e/full Computational and Experimental Modeling of the Bioheat Transfer Process of Perfusion in Tissue... A new mathematical model has been developed along with a new parameter estimation routine using surface temperature and heat flux measurements to estimate... of the https://nrc-publications.canada.ca/eng/view/object/?id=d6a4eb53-ad65-49f1-9ca9-4b7708c56967 Retrograde cerebral perfusion results in flow distribution abnormalities and neuronal damage: A... Retrograde cerebral perfusion results in flow distribution abnormalities and neuronal damage: A magnetic resonance imaging and histopathological study in pigs in flow https://publications-cnrc.canada.ca/eng/view/object/?id=a37c7c0a-bad8-440d-972a-b7f44abf9ba4 Baculovirus expression system scaleup by perfusion of high-density Sf-9 cell cultures - NRC... Baculovirus expression system scaleup by perfusion of high-density Sf-9 cell cultures https://www.accessdata.fda.gov/scripts/cdrh/cfdocs/cfRes/res.cfm?id=183380 Class 2 Device Recall Terumo Advanced Perfusion System 1 perfusion systemclassdevicerecallterumo https://pure.psu.edu/en/publications/perfusion-separation-challenge/ Perfusion separation challenge - Penn State perfusionseparationchallengepennstate https://www.accessdata.fda.gov/scripts/cdrh/cfdocs/cfres/res.cfm?id=99576 Class 2 Device Recall Terumo Advanced Perfusion System 1 perfusion systemclassdevicerecallterumo https://functionalcirculation.com/ Functional Circulation - Perfusion & Transplantation Research Feb 5, 2026 - Discover our cutting-edge perfusion systems for transplantation research, utilizing machine learning to revolutionize the field. functionalcirculationperfusiontransplantationresearch https://docs.lib.purdue.edu/bmepubs/87/ "Myocardial Perfusion Pressure: A Predictor of 24Hour Survival During P" by Karl B. Kern, Gordon A.... Myocardial perfusion pressure, defined as the aortic diastolic pressure minus the right atria1 diastolic pressure, correlates with coronary blood flow during... https://pubmed.ncbi.nlm.nih.gov/14961584/ Perfusion of 99Tcm-labeled CD105 Mab into kidneys from patients with renal carcinoma suggests that... There is strong published and unpublished evidence that our CD105 Mab E9, which is highly reactive with angiogenic endothelial cells, could be a useful reagent... https://www.birmingham.ac.uk/news-archive/2020/liver-perfusion-could-save-7-in-10-rejected-donor-livers Liver perfusion could save 7 in 10 rejected donor livers - University of Birmingham A major study investigating the effectiveness of liver perfusion as a technique to improve the function of donor livers that would have otherwise been rejected... https://eprints.ncl.ac.uk/19700 Discrepancies between cerebral perfusion and metabolism after subarachnoid haemorrhage: a magnetic... subarachnoid haemorrhagediscrepanciescerebralperfusion https://experts.arizona.edu/en/publications/high-permeability-region-size-on-perfusion-ct-predicts-hemorrhagi/ High-permeability region size on perfusion CT predicts hemorrhagic transformation after intravenous... https://tobias-lib.uni-tuebingen.de/xmlui/handle/10900/103921 Assessment of Hepatic Perfusion Using GRASP MRI Bringing Liver MRI on a New Level https://pubchem.ncbi.nlm.nih.gov/patent/US-2014163403-A1 Automated determination of arterial input function areas in perfusion analysis - Patent... US-2014163403-A1 chemical patent summary. function areasautomateddeterminationarterialinput https://experts.arizona.edu/en/publications/tissue-negative-transient-ischemic-attack-is-there-a-role-for-per/ Tissue-negative transient ischemic attack: Is there a role for perfusion MRI? - University of...