Robuta

https://www.redcrossblood.org/ Donate Blood, Platelets or Plasma. Give Life | Red Cross Blood Blood donors report feeling a sense of great satisfaction after making their blood donation. Why? Because helping others in need just feels good. Donate blood... donate bloodgive lifeplateletsplasmared https://www.vitalant.org/ Donate Blood, Plasma and Platelets | Vitalant donate bloodplasmaplatelets https://www.wikidata.org/wiki/Q47883016 Binding of thrombin to human platelets - Wikidata scientific article published on February 1, 1974 bindingthrombinhumanplateletswikidata https://www.biochemie.abi.med.uni-muenchen.de/publications/article/pub_1992_001.html Detection of distinct isoform patterns of the beta-amyloid precursor protein in human platelets and... https://ast.wiktionary.org/wiki/platelets platelets - Wikcionariu plateletswikcionariu https://pubmed.ncbi.nlm.nih.gov/41029912/ Mitochondrial respiratory function in human platelets: Influence of sample preparation, assay... Circulating blood cells such as platelets represent a readily available sample type to determine mitochondrial function in humans. Here, we set out to... respiratory functionin humansample preparationmitochondrial https://research.birmingham.ac.uk/en/datasets/research-data-supporting-heparin-and-heparin-proteoglycan-mimetic/ Research data supporting "Heparin and heparin proteoglycan-mimetics activate platelets via PEAR1... research datasupportingheparin https://www.redcross.org/local/new-jersey/about-us/news-and-events/press-releases/donate-now-to-keep-blood-and-platelets-stocked-when-winter-weath.html Donate now to keep blood and platelets stocked when winter weather hits | News | Red Cross of New... https://researchconnect.buffalo.edu/en/publications/indomethacin-and-ibuprofen-inhibit-the-uptake-of-sup45supcasup2su/ Indomethacin and ibuprofen inhibit the uptake of 45Ca2+ by washed human platelets through a... https://scholars.cityu.edu.hk/en/publications/activation-of-platelets-adhered-on-amorphous-hydrogenated-carbon--2/ Activation of platelets adhered on amorphous hydrogenated carbon (a-C: H) films synthesized by... https://scholarcommons.sc.edu/eche_facpub/665/ "Covalent Grafting of Phenylphosphonate on Calcium Niobate Platelets" by S. Shori, Perry J.... By S. Shori, Perry J. Pellechia, Hans-Conrad zur Loye, et al., Published on 01/01/15 https://boris-portal.unibe.ch/entities/publication/29d26724-4b49-45b6-9c9c-0ef34ee4a752 Platelets and pathogens plateletspathogens https://bibliographie.uni-tuebingen.de/xmlui/handle/10900/144137?show=full Cyclophilin A Is Not Acetylated at Lysine-82 and Lysine-125 in Resting and Stimulated Platelets https://pubmed.ncbi.nlm.nih.gov/15147815/?dopt=Abstract Biomaterial-associated thrombosis: roles of coagulation factors, complement, platelets and... Our failure to produce truly non-thrombogenic materials may reflect a failure to fully understand the mechanisms of biomaterial-associated thrombosis. The... biomaterialassociatedthrombosisrolescoagulation https://www.vice.com/en/tag/blood-platelets/ blood platelets Archives - VICE bloodplateletsarchivesvice https://ub01.uni-tuebingen.de/xmlui/handle/10900/66815 Platelets and the complement cascade in atherosclerosis and theplateletscomplementcascadeatherosclerosis https://www.wikidata.org/wiki/Q70084349 Effect of anti-inflammatory agents on platelets - Wikidata scientific article published on 01 April 1968 anti inflammatoryeffectagentsplateletswikidata https://umu.diva-portal.org/smash/record.jsf?pid=diva2:915462 Rearranged EML4-ALK fusion transcripts sequester in circulating blood platelets and enable... fusion transcripts https://research.birmingham.ac.uk/en/projects/interaction-between-neutrophils-and-platelets-in-flow-basedmodels/ Interaction between neutrophils and platelets in flow-basedmodels of vascular injury - University... in flow https://researchprofiles.ku.dk/da/publications/the-inflammatory-and-tumor-promoting-sesquiterpene-lactone-thapsi/ The inflammatory and tumor-promoting sesquiterpene lactone, thapsigargin, activates platelets by... inflammatorytumorpromoting https://case.edu/medicine/about/stopping-heavy-bleeding-next-generation-artificial-platelets Stopping heavy bleeding with next-generation artificial platelets | School of Medicine | School of... Biomedical researchers at Case Western Reserve University report that their latest innovation in developing synthetic platelets could help save lives ... heavy bleedingnext generationschool ofstopping https://health.economictimes.indiatimes.com/tag/%22poorly+preserved%22+platelets Poorly preserved platelets - Latest poorly preserved platelets , Information & Updates - Health -ET... ETHealthworld.com brings latest poorly preserved platelets news, views and updates from all top sources for the Indian Health industry. latest informationpoorlypreservedplateletsupdates https://pure.psu.edu/en/publications/a-mitogenic-factor-for-transformed-cells-from-human-platelets/ A mitogenic factor for transformed cells from human platelets. - Penn State factortransformed https://www.techtransfer.nih.gov/patent/e-388-1983-0-pct-02 Purified transforming growth factor-beta derived from human platelets and placentas | Technology... growth factor https://scholars.uky.edu/es/publications/properties-of-procoagulant-platelets-defining-and-characterizing-/ Properties of procoagulant platelets: Defining and characterizing the subpopulation binding a... propertiesplateletsdefining https://researchportalplus.anu.edu.au/en/publications/constitutive-dimerization-of-glycoprotein-vi-gpvi-in-resting-plat/ Constitutive dimerization of glycoprotein VI (GPVI) in resting platelets is essential for binding... https://www.wikidata.org/wiki/Q39340022 Factors responsible for ADP-induced release reaction of human platelets - Wikidata scientific article published on June 1975 factorsresponsibleadpinduced https://www.med.unc.edu/medicine/news/monroe-fager-publish-stopping-the-bleed-when-platelets-dont-stick/ Monroe, Fager Publish "Stopping the bleed when platelets don't stick" | Department of Medicine Feb 20, 2024 - Dougald Monroe, PhD, professor of medicine in the Division of Hematology and the UNC Blood Research Center, co-authored an article with Ammon Fager, MD, PhD,... https://pubmed.ncbi.nlm.nih.gov/21258396/ Contribution of platelets to tumour metastasis Extensive experimental evidence shows that platelets support tumour metastasis. The activation of platelets and the coagulation system have a crucial role in... contributionplateletstumourmetastasis https://www.nhl.com/kings/news/platelets-for-playoffs-26 Platelets For Playoffs Takes Place at CHLA April 20-22 | Los Angeles Kings One lucky fan will win Playoff Tickets to Home Game 2 at Crypto.com Arena! https://pubmed.ncbi.nlm.nih.gov/33147989/ Phosphoproteomic Analysis of Platelets in Severe Obesity Uncovers Platelet Reactivity and Signaling... Our results provide novel information on platelet phosphorylation changes related to obesity, revealing the impact of this chronic pathology on platelet... severe obesity https://www.techtransfer.nih.gov/patent/e-388-1983-0-au-09 Transforming growth factor-Beta from human platelets | Technology Transfer growth factortransformingbetahumanplatelets https://timesofindia.indiatimes.com/world/uk/astrazeneca-covid-vaccine-linked-with-a-small-risk-of-low-blood-platelets-study/articleshow/83394972.cms AstraZeneca Covid vaccine linked with a small risk of low blood platelets: Study - Times of India UK News: LONDON: The Oxford-AstraZeneca vaccine, known in India as Covishield, may be associated with a very small risk of developing a blood condition charact. https://www.sciencedaily.com/releases/2002/12/021216070816.htm U. Va. Researchers Uncover Role Of Platelets In Hardening Of The Arteries | ScienceDaily Scientists at the University of Virginia School of Medicine have discovered a new contributor to atherosclerosis, the most common form of hardening of the... https://portal.fis.tum.de/en/publications/platelets-induce-alterations-of-chemotactic-and-adhesive-properti/ Platelets induce alterations of chemotactic and adhesive properties of endothelial cells mediated... endothelial cellsplateletsinducealterations https://pure.psu.edu/en/publications/the-differential-inhibition-of-prostaglandin-synthesis-in-platele/ The differential inhibition of prostaglandin synthesis in platelets and vascular tissue in response... https://pubmed.ncbi.nlm.nih.gov/40405165/ Photo-controlled co-delivery of verteporfin and acriflavine via platelets achieves potentiated... The potential of glioblastoma (GBM) photodynamic therapy (PDT) is limited by inadequate GBM drug delivery, and the development of resistance to PDT as a result... https://pubmed.ncbi.nlm.nih.gov/14699162/ Munc13-4 is a GTP-Rab27-binding protein regulating dense core granule secretion in platelets Platelets store self-agonists such as ADP and serotonin in dense core granules. Although exocytosis of these granules is crucial for hemostasis and thrombosis,... https://pubmed.ncbi.nlm.nih.gov/37246517/ F11R/JAM-A: why do platelets express a molecule which is also present in tight junctions? F11 receptor (F11R)/Junctional Adhesion Molecule -A (JAM-A) is a transmembrane protein which belongs to the immunoglobulin superfamily of cell adhesion... https://systemsbiology.ucsd.edu/index.php/publications/2014/metabolomic-analysis-platelets-during-storage-comparison-between-apheresis-and Metabolomic analysis of platelets during storage: a comparison between apheresis- and buffy... https://researchprofiles.ku.dk/en/publications/prophylactic-platelets-in-dengue-survey-responses-highlight-lack-/ Prophylactic platelets in dengue: survey responses highlight lack of an evidence base - University... https://research.ibm.com/publications/scalable-multiscale-modeling-of-platelets-with-100-million-particles Scalable multiscale modeling of platelets with 100 million particles for Journal of Supercomputing... Scalable multiscale modeling of platelets with 100 million particles for Journal of Supercomputing by Changnian Han et al. https://www.thermofisher.com/blog/behindthebench/what-happened-to-my-platelets/ What Happened to my Platelets? - Behind the Bench May 12, 2016 - A research team, comprised of scientists from Sweden, Germany and Canada, have published a paper profiling the changes in gene expression from stored platelets... what happened tobehind theplateletsbench https://www.redcross.org/local/california/los-angeles/about-us/news-and-events/press-releases/red-cross--help-prevent-blood-shortages-in-2025-by-giving-blood-.html Red Cross: Help prevent blood shortages in 2025 by giving blood or platelets now https://www.ludwig.ox.ac.uk/news/researchers-at-ludwig-oxford-identify-a-new-role-for-platelets-which-could-improve-cancer-detection?ref=image Researchers at Ludwig Oxford identify a new role for platelets which could improve cancer detection... Researchers led by Bethan Psaila and postdoc Lauren Murphy have recently published their findings exploring a new role for platelets in Science. https://epubs.utah.edu/index.php/URJ/article/view/1493 INDUCTION OF NEUTROPHIL EXTRACELLULAR TRAP (NET) FORMATION BY STORED PLATELETS | Undergraduate... inductionneutrophilextracellulartrap https://anindianandagypsy.blogspot.com/2024/08/platelets-going-low-and-new-phone.html An Indian and a Gypsy: Platelets going low and new phone. I've been busy for the last couple of months. First Our son came down from Tennesse to help on the motor home where water had run in and me... and aindiangypsyplateletsgoing https://cordis.europa.eu/project/id/215820/results/es An integrated study on three novel regulatory hubs in megakaryocytes and platelets, discovered as... Deliverables, publications, datasets, software, exploitable results https://pubmed.ncbi.nlm.nih.gov/40189792/?dopt=Abstract Platelets mirror changes in the frontal lobe antioxidant system in Alzheimer's disease Platelets mirror several Alzheimer's disease (AD)-dependent neuronal changes, valuable for blood tests. As a start, 60 AD-associated frontal lobe proteins were... in thefrontal lobe https://health.economictimes.indiatimes.com/news/policy/no-dearth-of-platelets-beds-for-dengue-patients-in-up-dy-cm-pathak/95275619 No dearth of platelets, beds for dengue patients in UP: Dy CM Pathak, ETHealthworld "There is a panic among people about Dengue due to the media. In Oct last year, there were 17-18 thousand Dengue cases. Presently, till last night there were... https://www.redcross.org/local/california/los-angeles/about-us/news-and-events/press-releases/red-cross--bring-friends-to-give-lifesaving-blood-or-platelets.html Red Cross: Bring FRIENDS to give lifesaving blood or platelets red crossbring friendsto givelifesaving bloodplatelets https://www.diannevanderwal.com/ Platelets | Dr Dianne van der wal I'm Dr Dianne van der Wal, a medical scientist and I study factors influencing quality of smallest blood cells, the platelets, important for transfusion of... plateletsdrdiannevander https://pubmed.ncbi.nlm.nih.gov/26963053/ NOX 5 is expressed in platelets from patients with chronic granulomatous disease NOX 5 is expressed in platelets from patients with chronic granulomatous disease https://www.amtas.washington.edu/publications/effects-of-average-number-of-platelets-through-the-thickness-and-platelet-width-on-the-mechanical-properties-of-discontinuous-fiber-composites/ Effects of average number of platelets through the thickness and platelet width on the mechanical... https://pubmed.ncbi.nlm.nih.gov/33110200/ Platelets enhance malignant behaviours of gastric cancer cells via direct contacts In this study, we aimed to analyse human cancer cell-platelet interactions in functional cell analyses and explore the molecular mechanisms behind tumour... gastric cancerplateletsenhancemalignantbehaviours https://www.redcross.org/local/california/northern-california-coastal/about-us/news-and-events/press-releases/weather-impact--give-red-cross-blood-or-platelets-now.html Donate blood or platelets now | News | American Red Cross donate bloodnow newsamerican redplateletscross https://www.redcross.org/local/kansas/about-us/news-and-events/news/donate-blood-or-platelets-during-the-wichita-and-sedgwick-county.html Donate blood or platelets | Battle of the Badges | News Article | Kansas Region battle of the badgesdonate blood https://www.proquest.com/docview/1710061935 Energy metabolism of platelets during activation, oxidative stress and storage - ProQuest Explore millions of resources from scholarly journals, books, newspapers, videos and more, on the ProQuest Platform. energy metabolismoxidative stressplatelets https://pubs.rsc.org/en/Content/ArticleLanding/2020/FD/D0FD00024H Disordered wax platelets on Tradescantia pallida leaves create golden shine - Faraday Discussions... Plants have various strategies to protect themselves from harmful light. An example of such a protective mechanism is the growth of epicuticular... tradescantia pallida https://pubmed.ncbi.nlm.nih.gov/17194695/ LDL are oxidatively modified by platelets via GP91(phox) and accumulate in human monocytes Oxidative stress-mediated LDL modification has a key role in initiation of the atherosclerotic process. Platelets produce reactive oxidant species (ROS) upon... https://ub01.uni-tuebingen.de/xmlui/handle/10900/62691 Expression of anaphylatoxin receptors on platelets in patients with coronary heart disease https://www.redcross.org/local/illinois/about-us/news-and-events/give-blood-or-platelets-and-give-patients-time-this-holiday-seas.html Give blood or platelets and give patients time this holiday season give bloodplateletspatientstimeholiday https://research.ibm.com/publications/theory-of-domain-wall-motion-in-magnetic-films-and-platelets Theory of domain-wall motion in magnetic films and platelets for Journal of Applied Physics - IBM... Theory of domain-wall motion in magnetic films and platelets for Journal of Applied Physics by J.C. Slonczewski https://tobias-lib.uni-tuebingen.de/xmlui/handle/10900/104171 Heat-Shock Protein 27 (HSPB1) Is Upregulated and Phosphorylated in Human Platelets during... heat shock protein https://sbrg.ucsd.edu/publications/2012/intracellular-metabolite-profiling-platelets-evaluation-extraction-processes-and Intracellular metabolite profiling of platelets: evaluation of extraction processes and... metabolite profilingextraction processesintracellularplateletsevaluation https://www.afcent.af.mil/Units/455th-Air-Expeditionary-Wing/Photos/igphoto/2001805471/ Al Udeid ships its first unit of cold storage platelets to the AOR Platelets are separated out and collected during apheresis at Al Udeid, Air Base, Qatar, Aug. 23, 2017. The platelets will be shipped to locations across the... https://engineering.case.edu/news/biomedical-engineer-explores-new-use-synthetic-platelets-treating-inherited-bleeding-disorders Biomedical engineer explores new use for synthetic platelets: treating inherited bleeding disorders... biomedical engineer https://collections.nlm.nih.gov/catalog/nlm:nlmuid-101437665-img Become one of the special people: make a date to give blood, platelets and plasma today - Digital... https://publikationen.uni-tuebingen.de/xmlui/handle/10900/89032 HMGB1 Expression Level in Circulating Platelets is not Significantly Associated with Outcomes in... https://events.miami.edu/event/oneblood_plasma_platelets_drive_at_stand_residential_college OneBlood Plasma + Platelets Drive at Stanford Residential College - University of Miami UM students, facaulty and UMPD will be able to donate blood, plasma and platelets. The plasma donations will go towards helping COVID-19 patients and for... residential collegeuniversity ofplasmaplateletsdrive https://www.redcross.org/local/new-jersey/about-us/news-and-events/press-releases/bring-friends-to-give-lifesaving-blood-or-platelets-in-nj.html Bring FRIENDS to give lifesaving blood or platelets in NJ | News | Red Cross of New Jersey https://www.ebsco.com/research-starters/health-and-medicine/platelets-thrombocytes Platelets (thrombocytes) | Health and Medicine | Research Starters | EBSCO Research health and medicine researchplateletsstartersebsco https://tobias-lib.ub.uni-tuebingen.de/xmlui/handle/10900/104085?show=full Blood donor-derived buffy coat to produce platelets in vitro blood donorbuffy coatderivedproduceplatelets https://cordis.europa.eu/project/id/215820/results/de An integrated study on three novel regulatory hubs in megakaryocytes and platelets, discovered as... Deliverables, publications, datasets, software, exploitable results https://www.redcrossblood.org/donate-blood/how-to-donate/types-of-blood-donations.html Donate Blood, Plasma or Platelets | Red Cross Blood Learn more about the different types of blood donations and who they help. Giving the donate bloodplasmaplateletsredcross https://ub01.uni-tuebingen.de/xmlui/handle/10900/70539 Using six-colour flow cytometry to analyse the activation and interaction of platelets and... https://www.redcross.org/local/texas/north-texas/about-us/news-and-events/press-releases/red-cross--patients-needing-blood-or-platelets-rely-on-committed.html Red Cross: Patients Needing Blood or Platelets Rely on Committed Blood Donors red crossrely onpatientsneedingblood https://pubmed.ncbi.nlm.nih.gov/33155867/ Technical and biological review of authorized medical devices for platelets-rich plasma preparation... Platelet-rich plasma (PRP) has seen increased interest and utilization over the past decade, particularly in the field of musculoskeletal disease. This growth... https://sheffield.ac.uk/news/researchers-present-first-findings-blood-clotting-low-platelets-after-covid-19-vaccination Researchers present first findings on blood clotting with low platelets after COVID-19 vaccination... A national team of researchers have defined criteria for the diagnosis of patients with blood clotting associated with the Oxford Astrazeneca Covid vaccination. https://experts.mcmaster.ca/scholarly-works/1608705 Hypersensitivity to ADP of platelets from diabetic... Learn about the scholarly work entitled Hypersensitivity to ADP of platelets from diabetic... hypersensitivityadpplateletsdiabetic https://digital.library.adelaide.edu.au/items/41fb97c6-feb7-41dc-8758-39f5294f98bb Interface modification of clay and graphene platelets reinforced epoxy nanocomposites: a... The interface between the matrix phase and dispersed phase of a composite plays a critical role in influencing its properties. However, the intricate... interfacemodificationclay https://nrc-publications.canada.ca/fra/voir/objet/?id=648a0ab0-6485-42aa-b8c4-0fbd58d64ad9 Characterization of alpha platelets in a near alpha Ti alloy - Archives des publications du CNRC -... Characterization of alpha platelets in a near alpha Ti alloy https://research.tue.nl/en/publications/a-novel-approach-to-optimal-blood-platelets-logistics-2/ A novel approach to optimal blood platelets logistics - Research portal Eindhoven University of... a novel approach https://tobias-lib.uni-tuebingen.de/xmlui/handle/10900/55161 Expression of stromal cell-derived factor-1 receptors CXCR4 and CXCR7 on circulating platelets of... https://meetings.aps.org/Meeting/DFD21/Session/T14.5 APS -74th Annual Meeting of the APS Division of Fluid Dynamics - Event - The dynamics of platelets... annual meetingof thefluid dynamicsaps https://experts.mcmaster.ca/scholarly-works/2148405 The Prognostic Value of Reticulated Platelets in... Learn about the scholarly work entitled The Prognostic Value of Reticulated Platelets in... prognosticvaluereticulatedplatelets https://pubmed.ncbi.nlm.nih.gov/31601520/ Platelets in Host Defense: Experimental and Clinical Insights Platelets are central players in thrombosis and hemostasis but are increasingly recognized as key components of the immune system. They shape ensuing immune... host defenseplateletsexperimentalclinicalinsights https://www.redcross.org/local/texas/north-texas/about-us/news-and-events/press-releases/red-cross--help-keep-emergency-rooms-ready-by-giving-blood-or-pl.html Red Cross: Help Keep Emergency Rooms Ready by Giving Blood or Platelets red crossemergency rooms https://rarediseases.info.nih.gov/diseases/10357/primary-release-disorder-of-platelets Primary release disorder of platelets | About the Disease | GARD Find symptoms and other information about Primary release disorder of platelets. about the diseaseprimaryreleasedisorderplatelets https://www.birmingham.ac.uk/news-archive/2017/plenary-platelets-paper-for-mike-tomlinsons-group Plenary Platelets paper for Mike Tomlinson's group - University of Birmingham 'Tetraspanin Tspan9 regulates platelet collagen receptor GPVI lateral diffusion and activation' is the Plenary Paper in the latest issue of the journal... s groupuniversity ofplenaryplateletspaper https://tobias-lib.uni-tuebingen.de/xmlui/handle/10900/62691 Expression of anaphylatoxin receptors on platelets in patients with coronary heart disease https://rarediseases.info.nih.gov/diseases/17574/x-linked-dyserythropoietic-anemia-with-abnormal-platelets-and-neutropenia X-linked dyserythropoietic anemia with abnormal platelets and neutropenia | About the Disease | GARD Find symptoms and other information about X-linked dyserythropoietic anemia with abnormal platelets and neutropenia. https://www.redcross.org/local/california/los-angeles/about-us/news-and-events/press-releases/keep-the-blood-supply-blooming--give-blood-or-platelets-now.html Keep the blood supply blooming: Give blood or platelets now the bloodkeepsupplybloominggive https://research.birmingham.ac.uk/en/publications/hypertension-platelets-and-the-endothelium-the-thrombotic-paradox/ Hypertension, platelets and the endothelium: The thrombotic paradox of hypertension (or 'Birmingham... and thehypertensionplateletsendotheliumparadox https://bibliographie.uni-tuebingen.de/xmlui/handle/10900/94950 Secreted Immunomodulatory Proteins of Staphylococcus aureus Activate Platelets and Induce Platelet... staphylococcus aureussecretedimmunomodulatoryproteins https://theses.gla.ac.uk/72726/ Studies on blood platelets in uraemia - Enlighten Theses studiesbloodplateletsenlightentheses https://pmc.ncbi.nlm.nih.gov/articles/PMC47934/ Glyceraldehyde-3-phosphate dehydrogenase is required for the transport of nitric oxide in platelets... Nitric oxide (NO) or NO-generating compounds like sodium nitroprusside (SNP) increase cellular levels of cGMP and produce S-nitrosylation of... https://www.cruk.cam.ac.uk/publications/conversion-of-platelets-from-a-proaggregatory-to-a-proinflammatory-adhesive-phenotype-role-of-paf-in-spatially-regulating-neutrophil-adhesion-and-spreading/ Conversion of platelets from a proaggregatory to a proinflammatory adhesive phenotype: role of PAF... Authors: S Kulkarni, KJ Woollard, S Thomas, D Oxley, SP Jackson Journal name: Blood Citation info: 110(6):1879-1886 Abstract: The ability of platelets to... https://tobias-lib.ub.uni-tuebingen.de/xmlui/handle/10900/43211 Translational regulation of the serum- and glucocorticoid-inducible kinase-1 (SGK1) in platelets https://bibliographie.uni-tuebingen.de/xmlui/handle/10900/142599 The Functionality of Cold-stored Platelets with Apoptosis Inhibition functionalitycoldstoredplateletsapoptosis