Robuta

https://www.mendeley.com/catalogue/b8a6dd5b-a232-349a-96f9-ed600b6cdb54/ Clinician characteristics and per... preview & related info | Mendeley (2015) Kuhn et al. Professional Psychology: Research and Practice. Using smartphones in the provision of evidence-based psychotherapy holds tremendous... related infocliniciancharacteristicsperpreview https://www.mendeley.com/catalogue/97acfdc9-ba2a-34d1-aa4c-5fb91551b9c7/ Spatio-temporal Variability of Di... preview & related info | Mendeley (2020) Shinde et al. Iranian Journal of Science and Technology - Transactions of Civil Engineering. Long-term discharge variability assessment in the river... related infospatiotemporalvariabilitydi https://www.mendeley.com/catalogue/796570c1-89f9-3c7f-b82d-add9ea7c2d2e/ Psychological responses of elite ... preview & related info | Mendeley (2018) Davies et al. Comparative Exercise Physiology. Sport is considered a high-risk environment for athletes sustaining injury. Athletes are known to... related infopsychologicalresponseselitepreview https://www.mendeley.com/catalogue/1aafc1a0-52fc-3d09-b159-163bee4169b4/ Tuberculosis Drug Discovery Estim... preview & related info | Mendeley (2024) Campos et al. Communications in Computer and Information Science. Tuberculosis is a contagious disease considered as world emergency by the World Health... drug discoveryrelated infotuberculosisestimpreview https://www.mendeley.com/catalogue/1dd7eef8-ffc1-327e-9beb-fc293d7139f3/ Introduction to: LGBTQIA+ Rights ... preview & related info | Mendeley (2021) Miles, Zelada. Bulletin of Latin American Research introduction tolgbtqia rightsrelated infopreviewmendeley https://www.mendeley.com/catalogue/cb1b3619-2f10-30a4-bd8c-84bff4342f7e/ Distinct Actions of the Thyroid H... preview & related info | Mendeley (2022) Mayerl et al. Cells. Inactivating mutations in the thyroid hormone (TH) transporter monocarboxylate transporter 8 (MCT8) result in Allan-Herndon-Dudley... of therelated infodistinctactionsthyroid https://www.mendeley.com/catalogue/24d41633-afad-339a-a4e4-85922c48bbe9/ Stronglyoides stercoralis infecti... preview & related info | Mendeley (2005) Ben-Youssef et al. Transplantation related infopreviewmendeley https://www.mendeley.com/catalogue/9d19bde5-323c-3714-aa70-79d2a5b60b33/ RFID Based Material Sorting Syste... preview & related info | Mendeley (2019). International Journal of Innovative Technology and Exploring Engineering. The SIMATIC RF200 IO-link is an inductive identification system module which... material sortingrelated inforfidbasedsyste https://www.mendeley.com/catalogue/7d42ef0c-e93e-3786-9aea-9d7cc5d37cf7/ Tuning charge density waves and m... preview & related info | Mendeley (2025) Wong et al. Materials Horizons. The emergence of exotic charge density waves (CDW) alongside ferrimagnetic materials opens exciting new possibilities... related infotuningchargedensitywaves https://www.mendeley.com/catalogue/afc9c917-382e-3d67-aec9-f17110c614fd/ A novel route towards high qualit... preview & related info | Mendeley (2013) Spyrou et al. Carbon. A new approach for the synthesis of graphite intercalation compounds (GICs), by the help of co-intercalant molecules, has been... a novelrelated inforoutetowardshigh https://www.mendeley.com/catalogue/df5279c0-4b84-3459-b87d-5262379eae9e/ Circular Economy as a Mechanism o... preview & related info | Mendeley (2022) Alvarez-Risco et al. CSR, Sustainability, Ethics and Governance. The COVID-19 pandemic has changed the entire global dynamic, causing numerous rapid... circular economyrelated infomechanismpreviewmendeley https://www.mendeley.com/catalogue/d093b65d-6972-333b-8050-dc372f629cee/ Demystifying machine learning in ... preview & related info | Mendeley (2025) Ghnatios et al. Current Opinion in Urology machine learningrelated infodemystifyingpreviewmendeley https://www.mendeley.com/catalogue/4856f9e6-fac1-3eee-8a8f-0be29c1590b9/ An acceptance and commitment ther... preview & related info | Mendeley (2015) Graham et al. Clinical Case Studies. To date, there is little support for the use of any psychotherapy to address post-stroke anxiety. Similarly, there... related infoacceptancecommitmenttherpreview https://www.mendeley.com/catalogue/820b39df-7b2e-3830-a9d1-f9b2af9304ab/ Extreme heat: a global call to ac... preview & related info | Mendeley (2025) Rakesh et al. Bulletin of the World Health Organization extreme heatglobal callrelated info https://www.mendeley.com/catalogue/cafd1712-a3de-3f0e-b6ab-a4e65752e508/ Systemic Inflammatory Markers and... preview & related info | Mendeley (2015) El Gammal et al. Open Journal of Respiratory Diseases. Background: Decreased physical capacity and increased systemic inflammatory response are... inflammatory markersrelated infosystemicpreviewmendeley https://www.mendeley.com/catalogue/95506dc8-4b16-3939-94f0-628eee4af965/ Increased machine availability in... preview & related info | Mendeley (2022) Vega-Alvites, Quiroz-Flores. Proceedings of the LACCEI international Multi-conference for Engineering, Education and Technology. The plastic industry in... machine availabilityrelated infoincreasedpreviewmendeley https://www.mendeley.com/catalogue/264e1ac8-d136-3963-a594-134147de4280/ Seroprevalence of anti-SARS-CoV-2... preview & related info | Mendeley (2022) Chisale et al. Reviews in Medical Virology. We estimated the seroprevalence of anti-severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)... related infoseroprevalenceantisarscov https://www.mendeley.com/catalogue/0fc28987-f64a-3b2a-8140-0deccc7358f4/ Intermittent Fasting: Exploring A... preview & related info | Mendeley (2024) Nye et al. Journal for Nurse Practitioners. Intermittent fasting is an eating pattern that restricts food intake for specific periods. Studies have... intermittent fastingrelated infoexploringpreviewmendeley https://www.mendeley.com/catalogue/5ac680ff-3267-3f4b-bc07-0f8316803039/ Effects of acute cytomegalovirus ... preview & related info | Mendeley (2011) Smelt et al. Cell Transplantation. Transplantation of pancreatic islets is a promising therapy for the treatment of type 1 diabetes mellitus. However,... related infoeffectsacutecytomegaloviruspreview https://www.mendeley.com/catalogue/e01bd3e1-7d97-3a93-aa19-a2b363b70441/ Selecting Enterprise Systems for ... preview & related info | Mendeley (2025) Wuttke. Americas Conference on Information Systems, AMCIS 2025. Scaling requires digital ventures to make changes to their organizational and technical... enterprise systemsrelated infoselectingpreviewmendeley https://www.mendeley.com/catalogue/117801c1-92df-359a-8b8e-94534ff7b661/ Affordances advancing user-create... preview & related info | Mendeley (2022) Ciuchita et al. Journal of Service Management. Purpose: Digital platform users not only consume but also produce communication related to their... user createrelated infoaffordancesadvancingpreview https://www.mendeley.com/catalogue/97c7d125-f837-3e7b-8fb5-b79bfae59370/ Tandem autologous hematopoietic s... preview & related info | Mendeley (2021) Liu et al. Haematologica. T-cell lymphoblastic lymphoma (T-LBL) is a highly aggressive form of lymphoma with poor clinical outcomes and no standard... related infotandemautologoushematopoieticpreview https://www.mendeley.com/catalogue/3195fde7-6ce3-3808-bf05-d0cf7c27a6f0/ Affective computational model to ... preview & related info | Mendeley (2018) Dawood et al. IEEE Access. This paper was inspired by looking at the central role of emotion in the learning process, its impact on students'... related infoaffectivecomputationalmodelpreview https://www.mendeley.com/catalogue/1769bf9f-5162-37c3-96f3-80c665c57338/ New Approaches to Using Old Artif... preview & related info | Mendeley (2024) Lecher et al. Limnology and Oceanography Bulletin. Collaborations between archeologists and aquatic scientists are driving forward a whole new... new approachesrelated infousingoldartif https://www.mendeley.com/catalogue/ad89f6b6-8fce-3434-8473-b8e6ff314b8d/ Impact of caloric test asymmetry ... preview & related info | Mendeley (2021) Liu et al. Journal of Laryngology and Otology. Objective This study aimed to examine the association between caloric asymmetry and response to treatment... related infoimpactcalorictestasymmetry https://www.mendeley.com/catalogue/d82fe7c7-db35-349b-8dc0-3f6b9daaabaa/ Plant-insect interactions: An evo... preview & related info | Mendeley (2002) Mello, Silva-Filho. Brazilian Journal of Plant Physiology. In this review, plant-insect interaction is discussed as a dynamic system, subjected to... related infoplantinsectinteractionsevo https://www.mendeley.com/catalogue/43ff88f7-e3b3-3f50-81a9-03f62fca5548/ CLINICAL MANAGEMENT OF ACUTE SKIN... preview & related info | Mendeley (2024) Beam. Clinical Management of Acute Skin Trauma. Trauma and subsequent injury to the skin are frequent with participation in athletic, recreational, and... clinical managementrelated infoacuteskinpreview https://www.mendeley.com/catalogue/d0fad914-841b-3532-83ba-361e4d27fa3b/ Practice-embodying institutions - preview & related info | Mendeley (2024) Petersen. Political Economy, Institutions and Virtue related infopracticeembodyinginstitutionspreview https://www.mendeley.com/catalogue/126a991c-3937-3f74-b5b2-cae344b997e8/ Humanitarian Logistics Budget Mod... preview & related info | Mendeley humanitarian logisticsrelated infobudgetmodpreview https://www.mendeley.com/catalogue/798e6b42-e29e-3158-9da3-f415431d6959/ Diversifying the Role of Distribu... preview & related info | Mendeley (2019) Ali et al. IEEE Transactions on Industry Applications. Diversifying the role of grid-side converters (GSCs) associated with distributed generation (DG)... the role ofrelated infopreviewmendeley https://www.mendeley.com/catalogue/7f31fd3e-307e-3e9d-95c3-b84aa0206615/ Strengthening Health Systems To F... preview & related info | Mendeley (2022) Knaul et al. Health Affairs. Nonpharmaceutical interventions such as stay-at-home orders continue to be the main policy response to the COVID-19... strengthening health systemsrelated infopreviewmendeley https://www.mendeley.com/catalogue/efeae1da-18fa-315d-81d3-ae15481d6d28/ Diversity of commensal Bacillus c... preview & related info | Mendeley (2006) Swiecicka, Mahillon. FEMS Microbiology Ecology. Although Bacillus cereus sensu lato are important both from an ecological and an economical point of... related infodiversitycommensalbacilluspreview https://www.mendeley.com/catalogue/fc94d4c4-b0ad-31d8-a2c0-6ff9aac4a8f5/ Brains for birds and babies: Neur... preview & related info | Mendeley (2017) Prather et al. Neuroscience and Biobehavioral Reviews. Language as a computational cognitive mechanism appears to be unique to the human species.... for birdsrelated infobrainsbabiesneur https://www.mendeley.com/catalogue/caf1dc68-1bb1-374a-b8d1-89cf960422da/ Cases on Entrepreneurship and Inn... preview & related info | Mendeley (2024) Schmutzler et al. Cases on Entrepreneurship and Innovation. Cases on Entrepreneurship and Innovation bridges the gap between the real-world complexities... on entrepreneurshiprelated infocasesinnpreview https://www.mendeley.com/catalogue/3ac7c37f-9fbd-33e9-bad5-d1e676642c4a/ Metal ions in stroke pathophysiol... preview & related info | Mendeley (2012) Li, Zhang. Metal Ion in Stroke. Metal ions are used in biology in many ways and are integrated parts of numerous enzymes and proteins. They function as... related infometalionsstrokepreview https://www.mendeley.com/catalogue/6855e2fd-8be1-38ce-b1c0-ffd11f89e7a5/ Silicon photonics for optical con... preview & related info | Mendeley (2015) Aalto et al. 2015 IEEE Optical Interconnects Conference, OI 2015. Silicon photonics enables optical interconnects with high bandwidth, long reach, low... silicon photonicsfor opticalrelated infopreviewmendeley https://www.mendeley.com/catalogue/4b3cb261-b639-3031-a5dd-827a236d3d59/ Fostering SME's co-development of... preview & related info | Mendeley (2021) Ferasso, Grenier. Technology in Society. We explore the linkage of specific sets of enablers for the knowledge-creation process (KCP) mobilized in... co developmentrelated infofosteringsmepreview https://www.mendeley.com/catalogue/7e427d4d-ae48-36a1-ad34-f6b3f33c22f7/ Experiences in Conservation Plann... preview & related info | Mendeley (2026) Angulo et al. Sustainable Development Goals Series. Conservation planning is a key process to both chart a clearer and more effective path toward... related infoexperiencesconservationplannpreview https://www.mendeley.com/catalogue/96b47ec6-d5f5-351d-9bdf-07a86d3ae7f1/ From data to decision: integratin... preview & related info | Mendeley (2026) Ghnatios et al. World Journal of Urology. Purpose: The proposed review aims to provide a guide on current developments of artificial intelligence in... related infodatadecisionpreviewmendeley https://www.mendeley.com/catalogue/559312b6-a9b7-3fb4-802a-de36c3c522e7/ Specificity in Change of Directio... preview & related info | Mendeley (2025) Keiner et al. Journal of Strength and Conditioning Research. This study aimed to evaluate the specificity of change of direction (COD) training by... related infospecificitychangepreviewmendeley https://www.mendeley.com/catalogue/72dcbdd2-139d-3e76-a02a-104855b59194/ Appraising endophyte - Plant symb... preview & related info | Mendeley (2019) Ahmad et al. Agronomy. Chickpea is an important leguminous crop that improves soil fertility through atmospheric nitrogen fixation with the help of... related infoappraisingplantpreviewmendeley https://www.mendeley.com/catalogue/358d6406-224c-384f-814b-148e86136825/ Mental health initiatives: Provid... preview & related info | Mendeley (2025) Terrell et al. Journal of American College Health. Objective: College students experience stressors that can increase the risk for mental health... mental health initiativesrelated infopreviewmendeley https://www.pierrolaw.com/family-disputes/ Family Disputes Related Info| Pierro Law family disputesrelated infopierrolaw https://www.mendeley.com/catalogue/50eda4b0-6d83-3503-89a8-3fb26c86ab80/ Getting Residents in the Game: An... preview & related info | Mendeley (2004) Gollin et al. Journal of Pediatric Surgery. Purpose: In a large children's hospital, the authors evaluated general surgery residents' experience with... in the gamerelated infogettingresidentspreview https://www.mendeley.com/catalogue/d9b134cc-6b49-3463-ab37-07920f108e4f/ Beyond paychecks and prestige: un... preview & related info | Mendeley (2025) de Jong et al. Review of Behavioral Finance. Purpose: We aim to explore and analyze job stress, satisfaction and career mobility among finance... related infobeyondpaychecksprestigeun https://www.mendeley.com/catalogue/f822d1f3-84cd-301b-8656-d1d615214591/ Inference patterns from Big Data ... preview & related info | Mendeley (2014) Prakashbhai, Pandey. Proceedings of the 5th International Conference on Confluence 2014: The Next Generation Information Technology Summit. This paper... big datarelated infoinferencepatternspreview https://www.mendeley.com/catalogue/6e370e86-a535-32a1-a5c1-3484a33be8e3/ Self-Resolving Vulvar Breast Tiss... preview & related info | Mendeley (2020) Larson et al. Journal of Human Lactation. Introduction: During the postpartum period, breast engorgement in preparation for lactation may trigger the... related infoselfresolvingvulvarbreast https://www.mendeley.com/catalogue/b3ed843e-8f1c-33b9-afc7-2b1ae7aed0d6/ Failure to Register as a Predicto... preview & related info | Mendeley (2012) Zgoba, Levenson. Sexual Abuse: Journal of Research and Treatment. This quasi-experimental study analyzed the recidivism outcomes of 1,125 sexual... failure to registerrelated infopreviewmendeley https://www.mendeley.com/catalogue/5496252f-0106-30b3-ba12-f75e9f32597b/ A roadmap to integrate astrocytes... preview & related info | Mendeley (2020) Kastanenka et al. GLIA. Systems neuroscience is still mainly a neuronal field, despite the plethora of evidence supporting the fact that astrocytes... related inforoadmapintegrateastrocytespreview https://utkarsh.com/current-affairs/state/state-news/website-booth-raabta-launched-by-punjab-for-election-related-information 'Booth Raabta' Website for election-related info in Punjab The Punjab District Election Officer has launched the website "Booth Raabta" to provide election-related information between voters and election authorities. website forelection relatedboothraabtainfo https://www.mendeley.com/catalogue/ec61bc4e-ef1d-31ce-bcab-d056f7b63a5b/ Free trade agreements and world o... preview & related info | Mendeley (2020) Baggio, Chong. Southern Economic Journal. We study the causal link between trade openness via free trade agreements (FTAs) and obesity rates. When... free trade agreementsworld orelated infopreviewmendeley https://nvqassignmenthelp.co.uk/blog/2024/08/ August 2024 - NVQ Assignments Blog - NVQ Diploma Related Info & News related infoaugustnvqassignmentsblog https://www.mendeley.com/catalogue/f6114d3f-c31b-3149-86fe-8054945ceca9/ Economic Insecurity - preview & related info | Mendeley (2014) Essenburg. The New Faces of American Poverty: A Reference Guide to the Great Recession, Volumes 1-2 related infoeconomicinsecuritypreviewmendeley https://www.mendeley.com/catalogue/6dba3baf-23e9-33af-8176-35b71b86ea53/ In-office technique for selective... preview & related info | Mendeley (2016) Wadhwani, Chung. Journal of Prosthetic Dentistry. A technique is described for increasing the surface area of a titanium abutment with hydrofluoric acid... in officerelated infotechniqueselectivepreview https://mailman.mit.edu/mailman/listinfo/robotics-related Robotics-related Info Page related inforobotics https://www.mendeley.com/catalogue/bdbdc82a-ec08-30a6-8104-3472510480c7/ Importance of subcellular metal p... preview & related info | Mendeley (2015) Campana et al. Environmental Science and Technology. The role of subcellular partitioning of copper on the sublethal effects to two deposit-feeding... importance ofrelated infosubcellularmetalpreview https://www.mendeley.com/catalogue/081264f8-ceaf-338f-83ab-1dc96b5dba46/ Development of binary eutectic or... preview & related info | Mendeley (2019). International Journal of Innovative Technology and Exploring Engineering. Solar thermal energy storage unit anchored fatty acids as Phase Change... related infodevelopmentbinaryeutecticpreview https://www.mendeley.com/catalogue/138785cc-0359-31c0-9d4a-a0773306ec78/ Processed Cheese and Substitute/I... preview & related info | Mendeley (2017) Fox et al. Fundamentals of Cheese Science. The development of pasteurised processed (also called process) cheese products (PCPs) in the early 1900s was... processed cheeserelated infosubstitutepreviewmendeley https://www.mendeley.com/catalogue/601a8f0b-45f3-3235-8326-28dd8751976c/ Organizational culture on the Fac... preview & related info | Mendeley (2021) Kurian et al. Online Information Review. Purpose: The purpose of this study is to identify organizational cultural factors and overarching themes on... organizational culturerelated infofacpreviewmendeley https://www.mendeley.com/catalogue/bec4284a-5891-3d2b-9dfb-864bf4476c23/ Transfer of Learning of New Nursi... preview & related info | Mendeley (2024) Roig-Ester et al. Education Sciences. While numerous studies have focused on the learning transfer of in-company training in past decades, relatively... related infotransferlearningnewnursi https://www.mendeley.com/catalogue/9db6fdf7-b7fc-3b7f-a40f-4ac27818f30f/ INDIGENOUS KNOWLEDGE AND INTERNAT... preview & related info | Mendeley (2023) Merino. The Routledge Handbook of International Law and Anthropocentrism. CInternational law is gradually recognising Indigenous knowledge (IK) as a... indigenous knowledgerelated infointernatpreviewmendeley https://www.mendeley.com/catalogue/97fe809c-fb89-35ce-8e10-2a6efd539cf6/ Evaluation of convalescent plasma... preview & related info | Mendeley (2021) Diago-Sempere et al. Trials. Background: COVID-19 is a respiratory disease caused by a novel coronavirus (SARS-CoV-2) and causes substantial morbidity... related infoevaluationconvalescentplasmapreview https://www.mendeley.com/catalogue/100f147b-b19f-3799-bc7a-4a0737dcdbb3/ Physician assistant job satisfact... preview & related info | Mendeley (2015) Hooker et al. Journal of Physician Assistant Education. Purpose: To examine physician assistant (PA) job satisfaction and identify factors predicting... physician assistant jobrelated infopreviewmendeley https://www.mendeley.com/catalogue/e727ecb1-2712-3712-8131-d81d112ea434/ Innovative Data Models: Transform... preview & related info | Mendeley (2025) Horr et al. Metals. As the use of data models and data science techniques in industrial processes grows exponentially, the question arises: to what... data modelsrelated infoinnovativetransformpreview https://www.mendeley.com/catalogue/6b9ef41d-d4e4-36e7-a96d-768d361bdce6/ Impact of The Nurses Education an... preview & related info | Mendeley of therelated infoimpactnurseseducation https://www.mendeley.com/catalogue/324d4ce8-1121-36f4-9f25-c128d38a4e72/ Ketamine Infusion (KI) in Treatme... preview & related info | Mendeley (2019) Griffiths et al. Open Journal of Depression ketamine infusionrelated infokitreatmepreview https://www.mendeley.com/catalogue/599a9618-335d-39dc-8643-960bf7cc07d2/ Accuracy of reporting of family h... preview & related info | Mendeley (2004) Mitchell et al. Gut. Background and aims: Family history is used extensively to estimate the risk of colorectal cancer but there is considerable... family hrelated infoaccuracyreportingpreview https://www.mendeley.com/catalogue/d9f18179-fe4a-34c9-8b15-b02de174a421/ Comparison of SUVs based on diffe... preview & related info | Mendeley (2016) Lambrecht et al. European journal of nuclear medicine and molecular imaging. Conference: 29th annual congress of the european association of nuclear... based onrelated infocomparisonsuvsdiffe https://www.mendeley.com/catalogue/e659941c-ea77-3c14-9aa1-337ed4a5747d/ Blood donor questionnaires and in... preview & related info | Mendeley (2024) Marrero-Rivera et al. Vox Sanguinis. Background and Objectives: Blood donor questionnaires are tools used to screen prospective blood donors to... blood donorin previewrelated infoquestionnairesmendeley https://www.mendeley.com/catalogue/2dcb1bc0-ad33-3d2f-a242-3c64025f502a/ On Tiny Feature Engineering: Towa... preview & related info | Mendeley (2024) Gomez-Bautista et al. Proceedings - 2024 IEEE/ACM Symposium on Edge Computing, SEC 2024. Robotic-based therapy is becoming a very popular treatment for... feature engineeringrelated infotinytowapreview https://www.mendeley.com/catalogue/87359278-7095-3ae6-913f-96daf4336b9b/ Implementation of Bayesian Model ... preview & related info | Mendeley (2025) Hurtado et al. Conference Proceedings of the Society for Experimental Mechanics Series. Simplifications and theoretical assumptions are often... implementation ofrelated infobayesianmodelpreview https://www.mendeley.com/catalogue/c7d2b143-4e21-37ac-8cb5-e402a8e429a3/ Patenting in the European medical... preview & related info | Mendeley (2013) Weenen et al. PharmaNutrition. Medical nutrition products are specific nutritional compositions for intervention in disease progression and symptom... in therelated infopatentingeuropeanmedical https://www.pierrolaw.com/advance-directive/ Advance Directive Related Info| Pierro Law advance directiverelated infopierrolaw https://techbric.com/ Tech Bric – Technology Related Info Here tech bricrelated infotechnology https://www.mendeley.com/catalogue/e856a2a5-bb07-3699-8bd7-7fcec5fa05a0/ A phase III, randomized, open-lab... preview & related info | Mendeley (2022) Agarwal et al. Future Oncology. Cabozantinib inhibits multiple receptor tyrosine kinases, including the TAM kinase family, and may enhance response to... phase iiiopen labrelated inforandomizedpreview https://www.mendeley.com/catalogue/cf9d8fd6-58df-38c5-8307-5cd1ac6a6d5e/ Carsharing: a systematic literatu... preview & related info | Mendeley (2021) Nansubuga, Kowalkowski. Journal of Service Management. Purpose: Following the recent surge in research on carsharing, the paper synthesizes this growing... related infocarsharingsystematicpreviewmendeley https://www.mendeley.com/catalogue/44299d2e-3316-35f1-9dd1-6d76ece5539d/ Antecedents of ethical infrastruc... preview & related info | Mendeley (2019) Einarsen et al. Personnel Review. Purpose Drawing on the resource-based view, the purpose of this paper is to examine the extent to which the level of... related infoantecedentsethicalpreviewmendeley https://www.mendeley.com/catalogue/b122cd3f-d75c-36f3-b27a-42f1f72f21ee/ Controlled human infection of hea... preview & related info | Mendeley (2026) Gbesemete et al. Open Forum Infectious Diseases related infocontrolledhumaninfectionhea https://www.mendeley.com/catalogue/9aec32d3-2567-3e46-bfa1-91f995aac284/ A computational analysis of the m... preview & related info | Mendeley (2025) Zeler et al. Energy Policy. Energy is pivotal to the sustainable development agenda for 2030. In this context, nuclear energy emerges as a potential... computational analysisof therelated infopreviewmendeley https://www.mendeley.com/catalogue/e8094fa6-d56e-3e29-a91b-d596f9637da2/ Personality and Health - preview & related info | Mendeley (2020) Martin, Maksoudian. The Wiley Encyclopedia of Personality and Individual Differences: Volume IV: Clinical, Applied, and Cross-Cultural Research.... personality and healthrelated infopreviewmendeley https://www.migrationconcern.com/ Migration Concern- Migration related info, news and service অভিবাসন ও প্রবাস বিষয়ক অনলাইন সংবাদমাধ্যম। নিরাপদ অভিবাসনসহ প্রবাসের সকল খবর ও তথ্য। বাংলায় বাংলাদেশসহ সারাবিশ্বের প্রবাসের সর্বশেষ সংবাদ, প্রতিবেদন ও বিশ্লেষণ... related infonews andmigrationconcernservice https://www.pierrolaw.com/administration/ Administration Related Info| Pierro Law related infoadministrationpierrolaw https://dailyloannews.com/ Daily Loan News – Loan Related Info Here daily loan newsrelated info https://www.mendeley.com/catalogue/561a9612-2594-315b-9c60-391b31a5228a/ 742 Modification of Lymphocyte Tr... preview & related info | Mendeley (2008) Murphy et al. Gastroenterology related infomodificationlymphocytetrpreview https://www.mendeley.com/catalogue/dabb3b0a-2f8d-3d88-8f85-8c075c5a283f/ Elastic and Elasto-Plastic Contac... preview & related info | Mendeley (2020). International Journal of Recent Technology and Engineering (IJRTE).... related infoelasticelastoplasticcontac https://www.mendeley.com/catalogue/2094c4e7-dfae-3136-9665-d859189e0ec1/ Distribution Network Optimization... preview & related info | Mendeley (2022) Pallete et al. Studies in Systems, Decision and Control. In recent years, palm oil has been established as the most-produced oilseed oil in the... distribution networkrelated infooptimizationpreviewmendeley https://www.mendeley.com/catalogue/21200c04-6c90-3d21-abac-011ccfd04eaa/ Early events in the endoplasmic r... preview & related info | Mendeley (2019) Preissler, Ron. Cold Spring Harbor Perspectives in Biology. The physiological consequences of the unfolded protein response (UPR) are mediated by... events inrelated infoearlypreviewmendeley https://www.mendeley.com/catalogue/cb244b9c-3812-3c80-94cb-2808278afca4/ Sperm proteomics: Fertility diagn... preview & related info | Mendeley (2014) Ko. Fertility and Sterility related infospermproteomicsfertilitydiagn https://www.mendeley.com/catalogue/4ec176f7-6ac8-353a-89e1-2ba926fb25bb/ Learning to discover value: Value... preview & related info | Mendeley (2020) Raja et al. Journal of Business Research. Many manufacturers invest in advanced services and solutions to achieve superior customer value; however,... to discoverrelated infolearningvaluepreview https://www.mendeley.com/catalogue/1db1643b-bae6-33e5-a511-298bab6c30ff/ CLARITY THROUGH THE KALEIDOSCOPE:... preview & related info | Mendeley the kaleidoscoperelated infoclaritypreviewmendeley https://www.mendeley.com/catalogue/3df08767-a355-39dc-9ee4-348771146033/ Unveiling the Role of BODIPY Dyes... preview & related info | Mendeley (2024) Seoneray et al. Solar RRL. Perovskite solar cells (PSCs) have become a research hotspot since their dramatic increase in power conversion efficiency... the role ofbodipy dyesrelated infounveilingpreview https://www.mendeley.com/catalogue/13c597eb-aafd-39f4-b800-d87884e7b0d9/ Practices, institutions, and just... preview & related info | Mendeley (2025) Petersen, Reyes. Just Price Theory: Historical Perspectives and Contemporary Insights. This chapter argues for the need to take virtue into account when... related infopracticesinstitutionspreviewmendeley https://www.mendeley.com/catalogue/4918e847-1d1f-349d-9d33-a96ccd6972f6/ The medial brachial fascial compa... preview & related info | Mendeley (2003) Tsao, Wilbourn. Neurology. Objective: To review clinical and electrodiagnostic features of the medial brachial fascial compartment syndrome, a... related infomedialbrachialfascialcompa https://www.mendeley.com/catalogue/6beea4ad-45b7-34a7-931f-639dc98b1961/ Physical fitness training for str... preview & related info | Mendeley (2020) Saunders et al. Cochrane Database of Systematic Reviews. Background Levels of physical activity and physical fitness are low aKer stroke. Interventions... physical fitnesstraining forrelated infostrpreview https://www.mendeley.com/catalogue/bcbb750a-b870-3386-bdc3-5579aaf3f06e/ Studies of nanostructures and con... preview & related info | Mendeley (2008) Chandra et al. Solid State Communications. Synthesis and characterization of the tailored nanostructured vanadium molybdenum oxide (V xMo1-xOy) system... related infostudiesnanostructuresconpreview https://www.mendeley.com/catalogue/21dd9c24-5583-312d-aeca-39454736ad1d/ Le calcium dans les aliments au s... preview & related info | Mendeley (2013) Joubrel et al. Pratiques en Nutrition. Essential for the body, sufficient calcium intake helps to renew and maintain healthy bones. The consumption of... le calciumles alimentsrelated infodans https://www.mendeley.com/catalogue/fbee4e0c-fdd3-3b9a-a533-df299691b22e/ A synopsis of Philippine Cyrtandr... preview & related info | Mendeley (2022) Olivar et al. Taxon. A taxonomic synopsis of Philippine Cyrtandra (Gesneriaceae) is presented. Following a study of 138 published names and their types,... a synopsisrelated infophilippinepreviewmendeley https://www.mendeley.com/catalogue/840737b7-26af-319d-988f-f4e1db840628/ Differences in DNA methylation of... preview & related info | Mendeley (2023) Ouni et al. Molecular Metabolism. Objectives: Better disease management can be achieved with earlier detection through robust, sensitive, and easily... dna methylationrelated infodifferencespreviewmendeley https://www.mendeley.com/catalogue/d1a015d4-512d-32ba-a832-1c5b7ed6c7bc/ Organisational responses to the e... preview & related info | Mendeley (2022) Stahl et al. AI and Society. The ethics of artificial intelligence (AI) is a widely discussed topic. There are numerous initiatives that aim to develop... to therelated infoorganisationalresponsespreview https://www.pierrolaw.com/long-term-care/lgbtq/ LGBTQ+ Related Info| Pierro Law related infolgbtqpierrolaw