Robuta

Sponsored by LiveJasmin Free Live Sex Chat with Sympathetic | LiveJasmin Explore the profile of Sympathetic. Chat for free on LiveJasmin and watch HD Live Sex cam shows! https://kfan.xyz/ kfan.xyz – sympathetic ghost mode kfanxyzsympatheticghostmode https://research.monash.edu/en/publications/the-effects-of-weight-loss-versus-weight-loss-maintenance-on-symp/ The effects of weight loss versus weight loss maintenance on sympathetic nervous system activity... sympathetic nervous systemweight loss https://pubmed.ncbi.nlm.nih.gov/31429767/?dopt=Abstract Dapagliflozin improves left ventricular remodeling and aorta sympathetic tone in a pig model of... 9 weeks of dapagliflozin treatment decreases hypertension and reverses LV concentric remodeling in HFpEF pigs partly by restraining sympathetic tone in the... https://pmc.ncbi.nlm.nih.gov/articles/PMC3844004/ Sympathetic axonopathies and hyperinnervation in the small intestine smooth muscle of aged Fischer... It is well documented that the intrinsic enteric nervous system of the gastrointestinal (GI) tract sustains neuronal losses and reorganizes as it ages. In... https://pure.psu.edu/en/publications/dichloroacetate-reduces-sympathetic-nerve-responses-to-static-exe/ Dichloroacetate reduces sympathetic nerve responses to static exercise - Penn State reducessympatheticnerveresponsesstatic https://www.frontiersin.org/journals/endocrinology/articles/10.3389/fendo.2024.1440070/full Frontiers | Sympathetic innervation of interscapular brown adipose tissue is not a predominant... Previous studies indicate that CNS administration of oxytocin (OT) reduces body weight in high fat diet-induced obese (DIO) rodents by reducing food intake a... brown adipose tissue https://experts.arizona.edu/en/publications/a-quantitative-analysis-of-the-sensory-and-sympathetic-innervatio/ A quantitative analysis of the sensory and sympathetic innervation of the mouse pancreas -... quantitative analysisof the https://pubmed.ncbi.nlm.nih.gov/36752452/ Acute Modulation of Left Ventricular Control by Selective Intracardiac Sympathetic Denervation Transvenous, anatomically driven axotomy targeting nerve fibers along the CS enables acute modulation of left ventricular control by selective intracardiac... acutemodulationleft https://pure.psu.edu/en/publications/sympathetic-and-hypothalamic-pituitary-adrenal-asymmetry-in-gener/ Sympathetic and hypothalamic-pituitary-adrenal asymmetry in generalized anxiety disorder - Penn... generalized anxiety disordersympatheticpituitaryadrenal https://pubmed.ncbi.nlm.nih.gov/33180998/ Increased sympathetic and haemodynamic responses to exercise and muscle metaboreflex activation in... Studies have reported abnormal cardiovascular responses to exercise in rheumatoid arthritis (RA) patients, but little is known regarding the underlying... increasedsympatheticresponses https://rsdinfo.com/ International RSD Foundation | Reflex Sympathetic Dystrophy (RSD) | Complex Regional Pain... The International RSD Foundation, provides free medical information regarding Reflex Sympathetic Dystrophy, RSD, Complex Regional Pain Syndrome, CRPS to RSD... reflex sympathetic dystrophyinternationalrsdfoundationcomplex https://gl.wiktionary.org/wiki/sympathetic sympathetic - Wiktionary sympatheticwiktionary https://pubmed.ncbi.nlm.nih.gov/15061159/?dopt=Abstract&holding=idemdclib_fft&otool=idemdclib Prevention of sympathetic and cardiac dysfunction after myocardial infarction in transgenic rats... To provide evidence for the role of angiotensin II locally produced in the brain in the development of sympathetic hyperactivity and heart failure after... https://pure.psu.edu/en/publications/effects-of-intermittent-hypoxia-on-sympathetic-activity-and-blood/ Effects of intermittent hypoxia on sympathetic activity and blood pressure in humans - Penn State https://indymermaid.blogspot.com/2012/06/getting-cricky-design-team-post.html?showComment=1340746093306 A Mermaids Crafts: Getting Cricky Design Team Post - Sympathetic Sayings Happy Tuesday, everyone!! I hope your week is starting out wonderfully :) It's my turn to design at Getting Cricky and today we are featur... design team postgetting crickymermaidscraftssympathetic https://research.monash.edu/en/publications/sympathetic-response-and-outcomes-following-renal-denervation-in-/ Sympathetic Response and Outcomes Following Renal Denervation in Patients With Chronic Heart... renal denervation https://dash.harvard.edu/entities/publication/73120378-9aa5-6bd4-e053-0100007fdf3b Delayed sympathetic dependence in the spared nerve injury (SNI) model of neuropathic pain Background: Clinical and experimental studies of neuropathic pain support the hypothesis that a functional coupling between postganglionic sympathetic efferent... https://www.frontiersin.org/journals/physiology/articles/10.3389/fphys.2016.00685/full Frontiers | Detection of Impaired Sympathetic Cerebrovascular Control Using Functional Biomarkers... This study sought to determine whether models of cerebrovascular function based on Laguerre-Volterra kernels that account for nonlinear cerebral blood flow (... frontiersdetectionimpairedsympatheticcerebrovascular https://restore-dc-catholicism.blogspot.com/2014/04/gay-sympathetic-sister-to-speak-at.html?m=0 Restore-DC-Catholicism: Gay-Sympathetic Sister To Speak At Mother Seton Event - Please Pray And... In a comment to one of my April 6 post, an anonymous reader mentioned that Sister Anne Bryan Smollin is to be the featured speaker at a brea... https://research.monash.edu/en/publications/preglomerular-and-postglomerular-resistance-responses-to-differen/ Preglomerular and Postglomerular Resistance Responses to Different Level of Sympathetic Activation... resistanceresponses https://www.wikidata.org/wiki/Q80327838 On vaso-dilator fibres in the sympathetic, and on the effect of circulating adrenaline in... scientific article published on 01 June 1932 in the https://dhdebates.gc.cuny.edu/read/untitled/section/360e4872-2dd2-4e75-b85c-cc6da32e5eaa 23. The Sympathetic Research Imagination: Digital Humanities and the Liberal Arts | Rachel Sagner... Transforming scholarly publications into living digital works humanities and liberal arts https://www.ajwrestorations.co.uk/ Williams Antique Furniture Restorers | Sympathetic Resoration antique furniturewilliamsrestorerssympathetic https://pubmed.ncbi.nlm.nih.gov/9041100/ Sympathetic cardioneuropathy in dysautonomias The results of 6-[18F]fluorodopamine positron-emission tomography and neurochemical analyses support a new clinical pathophysiologic classification of... sympathetic https://www.ojp.gov/ncjrs/virtual-library/abstracts/selling-confession-setting-stage-sympathetic-detective-time-limited Selling Confession: Setting the Stage With the Sympathetic Detective With a Time-Limited Offer |... setting the stage https://scholars.okstate.edu/en/publications/area-postrema-and-sympathetic-nervous-system-effects-of-vasopress/ Area postrema and sympathetic nervous system effects of vasopressin and angiotensin II - OSU Center... sympathetic nervous system https://psych.ucsb.edu/news-events/events/cardiac-sympathetic-dynamics-optimal-choice-context Cardiac Sympathetic Dynamics of Optimal Choice in Context | Psychological & Brain Sciences | UCSB optimal choice https://scholars.uky.edu/es/publications/chronic-renin-inhibition-lowers-blood-pressure-and-reduces-uprigh/ Chronic renin inhibition lowers blood pressure and reduces upright muscle sympathetic nerve... blood pressure https://ostrowonline.usc.edu/sympathetic-maintained-pain/ Three Types of Sympathetic Maintained Pain | Orofacial Medicine Dec 20, 2024 - Findings show sympathetic maintained pain exists when pain is dependent on nervous system activity. Read about the three types of pain. types ofthreesympatheticmaintainedpain https://pyramidcomm.blogspot.com/2006/11/sympathetic-newspapers.html Pyramid Comment: 'Sympathetic' Newspapers pyramidcommentsympatheticnewspapers https://research.monash.edu/en/publications/autonomic-markers-of-emotional-processing-skin-sympathetic-nerve-/ Autonomic markers of emotional processing: Skin sympathetic nerve activity in humans during... emotional processing https://portal.fis.tum.de/en/publications/mechanistic-insights-into-sympathetic-neuronal-regeneration-multi/ Mechanistic insights into sympathetic neuronal regeneration: Multitracer molecular imaging of... molecular imaginginsightssympatheticneuronalregeneration https://pmc.ncbi.nlm.nih.gov/articles/PMC4351482/ Predictive Value of Sympathetic Skin Response in Diagnosing Complex Regional Pain Syndrome: A... To investigate the predictive value of the sympathetic skin response (SSR) in diagnosing complex regional pain syndrome (CRPS) by comparing three diagnostic... https://www.jstage.jst.go.jp/article/jjp/90/3/90_3_247/_article Effects of Fragrance Inhalation on Sympathetic Activity in Normal Adults Access full-text academic articles: J-STAGE is an online platform for Japanese academic journals. effectsfragranceinhalationsympatheticactivity https://scholarworks.indianapolis.iu.edu/items/c089d78b-242e-4885-8f21-01d6691dc5b6 Voltage-Induced Ca2+ Release in Postganglionic Sympathetic Neurons in Adult Mice. Recent studies have provided evidence that depolarization in the absence of extracellular Ca2+ can trigger Ca2+ release from internal stores in a variety of... voltageinducedreleasesympatheticneurons https://researchconnect.buffalo.edu/en/publications/renal-sympathetic-nerve-activity-and-systemic-vascular-resistance/ Renal sympathetic nerve activity and systemic vascular resistance indogs during cardiopulmonary... renalsympatheticnerveactivity https://pure.psu.edu/en/publications/heightened-sympathetic-arousal-is-demonstrated-by-skin-conductanc/ Heightened sympathetic arousal is demonstrated by skin conductance responsivity to auditory stimuli... by skin https://www.nist.gov/publications/production-two-overlapping-bose-einstein-condensates-sympathetic-cooling Production of two overlapping Bose-Einstein condensates by sympathetic cooling | NIST productiontwooverlappingbose https://katalog.bibliothek.kit.edu/bib/7205 Details for: Sympathetic control of jejunal fluid and electrolyte transport : an experimental study... OPAC der KIT-Bibliothek https://researchconnect.buffalo.edu/en/publications/bone-morphogenetic-protein-7-stimulates-initial-dendritic-growth-/ Bone morphogenetic protein-7 stimulates initial dendritic growth in sympathetic neurons through an... bone morphogenetic protein https://pubmed.ncbi.nlm.nih.gov/15110014/ Activity in ventromedial prefrontal cortex covaries with sympathetic skin conductance level: a... We examined neural activity related to modulation of skin conductance level (SCL), an index of sympathetic tone, using functional magnetic resonance imaging... prefrontal cortex https://publikationen.uni-tuebingen.de/xmlui/handle/10900/71413 GSK3-controlled sympathetic activity in FGF23 production and FGF23 gene regulation by actin... https://pure.psu.edu/en/publications/a-comparative-validation-of-sympathetic-reactivity-in-children-an/ A comparative validation of sympathetic reactivity in children and adults - Penn State https://scholars.lib.ntu.edu.tw/entities/publication/1453191f-7405-4c5d-a79a-a0b58cf88efa Plexin-A3 and plexin-A4 restrict the migration of sympathetic neurons but not their neural crest... During development, the semaphorin family of guidance molecules is required for proper formation of the sympathetic nervous system. Plexins are receptors that... https://collections.nlm.nih.gov/?f%5Bdrep2.subjectAggregate%5D%5B%5D=Ophthalmia%2C+Sympathetic+--+etiology&per_page=20 Subjects: Ophthalmia, Sympathetic -- etiology - Digital Collections - National Library of Medicine... digital collectionsnational librarysubjectssympatheticetiology https://pure.psu.edu/en/publications/attenuation-of-regional-differentiation-of-sympathetic-nerve-acti/ Attenuation of regional differentiation of sympathetic nerve activity during sleep in humans - Penn... https://scholars.uky.edu/en/publications/presynaptic-modulation-of-evoked-ne-release-contributes-to-sympat/ Presynaptic modulation of evoked NE release contributes to sympathetic activation after pressure... https://portal.fis.tum.de/en/publications/modulation-of-sympathetic-vascular-tone-by-prostaglandins-in-cort/ Modulation of sympathetic vascular tone by prostaglandins in corticosterone-induced hypertension in... modulationsympatheticvasculartone https://scholars.duke.edu/publication/1700748 Scholars@Duke publication: Peripheral nerve transection predominantly drives sympathetic nerve... peripheral nervescholarsdukepublicationdrives https://derohlsen.blogspot.com/2011/12/arch-matheos-sympathetic-resonance.html Audiovisual Ohlsen Overkill: ARCH / MATHEOS - Sympathetic Resonance A blog about records, live music, photography and stuff. Most posts are in german, yet sometimes I switch to english. audiovisualoverkillarchsympatheticresonance https://www.latimes.com/politics/la-na-pol-immigration-poll-20180628-story.html Despite Trump's crackdown, Americans are more sympathetic to immigrants, poll shows - Los Angeles... Jun 28, 2018 - The share of Americans who would like to see fewer immigrants in the country has continued to decline despite President Trump's push to restrict both legal and... https://pure.psu.edu/en/publications/heat-stress-enhances-arterial-baroreflex-control-of-muscle-sympat/ Heat stress enhances arterial baroreflex control of muscle sympathetic nerve activity via increased... https://journals.publishing.umich.edu/mjm/article/id/6598/ Kahi | Stellate Sympathetic Ganglion Nerve Block for Dysgeusia and Parosmia After COVID-19... https://pubmed.ncbi.nlm.nih.gov/11695791/ Sympathetic surgery for psychiatry. Case report One of the authors has, for many years, operated patients suffering from social phobias by using compression block on the sympathetic nerve (1). The Finnish... sympatheticsurgerypsychiatrycasereport https://pure.psu.edu/en/publications/sympathetic-neural-mechanisms-of-cyclosporine-induced-hypertensio/ Sympathetic neural mechanisms of cyclosporine-induced hypertension - Penn State sympatheticneuralmechanismscyclosporineinduced https://ri.diva-portal.org/smash/record.jsf?faces-redirect=true&language=no&searchType=SIMPLE&query=&af=%5B%5D&aq=%5B%5B%5D%5D&aq2=%5B%5B%5D%5D&aqe=%5B%5D&pid=diva2%3A1042060&noOfRows=50&sortOrder=author_sort_asc&sortOrder2=title_sort_asc&onlyFullText=false&sf=all SenToy in fantasyA: designing an affective sympathetic interface to a computer game https://research.monash.edu/en/publications/erratum-the-role-of-the-sympathetic-nervous-system-in-the-regulat/ Erratum: The role of the sympathetic nervous system in the regulation of leptin synthesis in... sympathetic nervous systemerratumrole https://experts.colorado.edu/display/pubid_37562 AGING EFFECTS ON HUMAN SYMPATHETIC NEURONAL FUNCTION | CU Experts | CU Boulder aging effectshumansympatheticneuronalfunction https://vivo.colorado.edu/display/pubid_62226 Acclimatization to high altitude increase muscle sympathetic activity both at rest and during... https://research.monash.edu/en/publications/same-same-but-different-frazers-sympathetic-law-of-similarity-and/ Same same, but different: Frazer's Sympathetic Law of Similarity and the study of Greco-Roman... same but different https://pure.psu.edu/en/publications/reflex-sympathetic-activation-during-static-exercise-is-severely-/ Reflex sympathetic activation during static exercise is severely impaired in patients with... https://meetings-archive.aps.org/damop/2011/q1/102/ The influence of the micromotion on the sympathetic cooling of an ion immersed in an ultracold gas... We investigate the influence of ion micromotion in a Paul trap on the sympathetic cooling of an ion immersed in an ultracold gas or a Bose-Einstein Condensate. https://fresh-meducation.teachable.com/courses/fresh-med-u-relaxation-as-medicine/lectures/35691250 The Sympathetic Nervous System: The Stress Response | FRESH MED U Learn why relaxation is one of the "FRESH 5" in your recipe to health sympathetic nervous systemstress responsefreshmed https://profiles.wustl.edu/en/publications/necrotic-arachnidism-and-intractable-pain-from-recluse-spider-bit/ Necrotic arachnidism and intractable pain from recluse spider bites treated with lumbar sympathetic... https://pubmed.ncbi.nlm.nih.gov/16469832/ Hypothermia-enhanced splenic cytokine gene expression is independent of the sympathetic nervous... Splenic nerve denervation abrogates enhanced splenic cytokine gene expression responses to acute heating, demonstrating that hyperthermia-induced activation of... gene expression https://research.utwente.nl/en/publications/a-young-female-patient-with-reflex-sympathetic-dystrophy-of-the-u/ A young female patient with reflex sympathetic dystrophy of the upper limb in whom amputation... https://www.frontiersin.org/journals/physiology/articles/10.3389/fphys.2021.780713/full Frontiers | Spleen Perfusion as an Index of Gender Impact on Sympathetic Nervous System Response to... Objective: Sympathetic nervous system (SNS) reaction to exercise is gender dependent. Nevertheless, clinically applicable methods to identify this difference... https://www.scirp.org/journal/paperinformation?paperid=95535 The Neural Pathways for the Hypothetic Nociceptive-Sympathetic Coupling of NBA for Pain Sensation In May 2016, it was suggested by the US athletes playing games of National Basketball Association (NBA) in television that the pain sensation might result from... https://pubmed.ncbi.nlm.nih.gov/7560081/ Sympathetic neural mechanisms in obstructive sleep apnea Blood pressure, heart rate, sympathetic nerve activity, and polysomnography were recorded during wakefulness and sleep in 10 patients with obstructive sleep... sympatheticneuralmechanismssleepapnea https://pubmed.ncbi.nlm.nih.gov/38929350/ Can a Sacrococcygeal Epidural of 0.25% Bupivacaine Prevent the Activation of the Sympathetic... The ovariectomy (OVE) procedure can trigger somatosensory and visceral peritoneal nociception. Sacrococcygeal epidural (ScE) anesthesia may complement or... https://www.wikidata.org/wiki/Q68733176 An electron microscopic study of the early changes distal to a constriction in sympathetic nerves -... scientific article published on 01 March 1969 https://pure.psu.edu/en/publications/influence-of-microgravity-on-astronauts-sympathetic-and-vagal-res/ Influence of microgravity on astronauts' sympathetic and vagal responses to Valsalva's manoeuvre -... https://bashfulblogging.blogspot.com/2015/04/a-sympathetic-sketch.html?showComment=1430652728759 Bashful Blogging: A Sympathetic Sketch I have come to realize I rarely do sketch challenges. Come to think of it, I have trouble getting challenges done on time at all, but sketch... bashful bloggingsympatheticsketch https://dukespace.lib.duke.edu/items/0047b484-bc49-4af0-810b-0b01db94b75f Integration of Trapped Ion System and Sympathetic Cooling with Multi-isotope Ions ion system https://arxiv.org/abs/1507.07761 [1507.07761] Sympathetic cooling and detection of a hot trapped ion by a cold one Abstract page for arXiv paper 1507.07761: Sympathetic cooling and detection of a hot trapped ion by a cold one https://rqs.umd.edu/publications/analysis-ion-chain-sympathetic-cooling-and-gate-dynamics Analysis of ion chain sympathetic cooling and gate dynamics | Institute for Robust Quantum... With the support of the National Science Foundation, the NSF Quantum Leap Challenge Institute for Robust Quantum Simulation uses quantum simulation to gain... https://scholars.uky.edu/es/publications/influence-of-cold-induced-increases-in-sympathetic-nerve-activity/ Influence of cold-induced increases in sympathetic nerve activity on norepinephrine content in the... https://news.gallup.com/poll/657404/less-half-sympathetic-toward-israelis.aspx?ref=readtangle.com Less Than Half in U.S. Now Sympathetic Toward Israelis Mar 27, 2025 - More Americans express sympathy for the Israelis (46%) than the Palestinians (33%) in the Middle East situation, but the margin has shrunk to a new low. less thanhalfusympathetictoward https://vivo.colorado.edu/display/pubid_34231 Influence of adiposity on tonic sympathetic support of resting metabolism in healthy adults | CU... https://www.pearson.com/channels/anp/learn/bruce/the-autonomic-nervous-system/review-of-the-sympathetic-and-parasympathetic-divisions?chapterId=24afea94 Review of the Sympathetic and Parasympathetic Divisions Explained: Definition, Examples, Practice &... Master Review of the Sympathetic and Parasympathetic Divisions with free video lessons, step-by-step explanations, practice problems, examples, and FAQs. Learn... of thereviewsympathetic https://scholars.lib.ntu.edu.tw/entities/project/5d683bda-d66a-426b-91e0-49b5b8f1f878 Regional Waveform Symmetry and Variability during Habituation Process of Sympathetic Skin Response https://globalnews.ca/video/4999651/blair-says-federal-government-sympathetic-to-danforth-shooting-victims Blair says federal government sympathetic to Danforth shooting victims | Watch News Videos Online Watch Blair says federal government sympathetic to Danforth shooting victims Video Online, on GlobalNews.ca https://www.ophth.wisc.edu/blog/1982/10/01/sympathetic-ophthalmia-a-comparison-of-the-histopathological-features-from-a-chinese-and-american-series/ Sympathetic ophthalmia: a comparison of the histopathological features from a Chinese and American... PubMed ID: 7107131 Author(s): Kuo PK, Lubin JR, Ni C, Wang KM, Albert DM. Sympathetic ophthalmia: a comparison of the histopathological features from a Chinese... a comparisonof the https://researchconnect.buffalo.edu/en/publications/role-of-sympathetic-nerves-during-recovery-from-submersion-in-duc/ Role of sympathetic nerves during recovery from submersion in ducklings - SUNY University at Buffalo https://bashfulblogging.blogspot.com/2015/04/a-sympathetic-sketch.html?showComment=1430772851801 Bashful Blogging: A Sympathetic Sketch I have come to realize I rarely do sketch challenges. Come to think of it, I have trouble getting challenges done on time at all, but sketch... bashful bloggingsympatheticsketch https://www.frontiersin.org/journals/neuroscience/articles/10.3389/fnins.2021.707345/full Frontiers | Analytic and Integrative Framework for Understanding Human Sympathetic Arterial... Background: The sympathetic arterial baroreflex is a closed-loop feedback system for stabilizing arterial pressure (AP). Identification of unique functions o... frontiersanalyticintegrativeframeworkunderstanding https://portal.fis.tum.de/en/publications/effect-of-sympathetic-reinnervation-on-cardiac-performance-after-/ Effect of sympathetic reinnervation on cardiac performance after heart transplantation - Technical... heart transplantationeffectsympathetic https://scholarworks.indianapolis.iu.edu/items/35770182-e795-4278-ac4f-019c5ad7910c Method for Detection and Quantification of Non-Invasive Skin Sympathetic Nerve Activity Sympathetic nerve activity is an important trigger of cardiac arrhythmia. Our laboratory recently developed a new method for non-invasive recording of the skin... https://pubmed.ncbi.nlm.nih.gov/12213879/ Altered responsiveness of the hypothalamus-pituitary-adrenal axis and the sympathetic... A growing number of animal data strongly suggest that a hyporeactive hypothalamus-pituitary adrenal (HPA) axis may be pathologically significant by increasing... of thealteredresponsivenesshypothalamuspituitary https://med.ucf.edu/news/ucf-researchers-create-digital-map-of-sympathetic-nervous-system/ UCF Researchers Create Digital Map of Sympathetic Nervous System - College of Medicine May 3, 2023 - A team of UCF College of Medicine researchers has created a digital topographical map of the cardiac sympathetic neural network, the region that controls the... sympathetic nervous systemdigital mapucfresearcherscreate https://scholars.duke.edu/publication/1629352 Scholars@Duke publication: Sympathetic Cooling of Trapped Yb+ Ion Chain scholarsdukepublicationsympatheticcooling https://scholars.uky.edu/es/publications/facilitation-of-sympathetic-neurotransmission-contributes-to-angi/ Facilitation of sympathetic neurotransmission contributes to angiotensin regulation of body weight - facilitationsympatheticneurotransmissioncontributesangiotensin https://pure.psu.edu/en/publications/patterns-of-innervation-of-sympathetic-vascular-neurons-by-peptid/ Patterns of innervation of sympathetic vascular neurons by peptide- containing primary sensory... patternssympatheticvascular https://io.wiktionary.org/wiki/Specala:QuoLigasHike/sympathetic Pagini qui ligesas a(d) "sympathetic" - Wikivortaro a dpaginiquisympathetic https://pubmed.ncbi.nlm.nih.gov/34264434/ Gastric Bypass Sensitizes Sympathetic and Thermogenic Activity of Brown Adipose Tissue to Cold... https://pmc.ncbi.nlm.nih.gov/articles/PMC6605037/ Resting Amygdala Connectivity and Basal Sympathetic Tone as Markers of Chronic Hypervigilance - PMC Chronic hypervigilance, a state of sustained alertness and hyperarousal in the absence of threat, has been shown to predict poorer clinical outcomes... https://www.sympvibes.org/ Home | Sympathetic Vibrations The home page for Sympathetic Vibrations, the premier all-male a cappella group at Georgia Tech! sympatheticvibrations https://pubmed.ncbi.nlm.nih.gov/4080043/ Assessment of methods to estimate impairment of vagal and sympathetic innervation of the heart in... Assessment of methods to estimate impairment of vagal and sympathetic innervation of the heart in diabetic autonomic neuropathy https://www.business-standard.com/article/international/suspect-in-salman-rushdie-s-stabbing-showed-sympathy-to-iran-s-irs-report-122081300248_1.html Rushdie's stabbing suspect sympathetic to Iran's Revolutionary Guards: Rpt | International News... The 24-year-old man detained in connection with the stabbing of author Salman Rushdie was sympathetic to "Shia extremism" and the causes of Iran's Islamic... https://research.birmingham.ac.uk/en/publications/causes-and-consequences-of-sympathetic-over-activity-insights-fro/ Causes and consequences of sympathetic over-activity: Insights from human studies - University of...