https://best-restaurants-in-marrakech.com/low-variance-slots-that-still-pay-well/
Low Variance Slots That Still Pay Well - best-restaurants-in-marrakech
May 26, 2025 - When it comes to choosing a slot game to play, one of the key factors to consider Texas Holdem Poker is the game's variance, also known as volatility. This
low variance slotsbest restaurantsstill
https://variancejournal.org/article/133589-catastrophe-duration-and-loss-prediction-via-natural-language-processing
Catastrophe Duration and Loss Prediction via Natural Language Processing | Published in Variance
natural language processing
https://pedestrianobservations.com/2018/01/16/transit-and-scale-variance-part-2-soviet-triangles/
Transit and Scale Variance Part 2: Soviet Triangles | Pedestrian Observations
Continuing with my series on scale-variance (see part 1), I want to talk about a feature of transit networks that only exists at a specific scale: the Soviet...
transitscalevariancepartsoviet
https://variancefm.com/
Variance FM – Radio locale d'Auvergne – Puy-Guillaume 103.7FM – écouter en live
https://digitalcollections.library.oregon.gov/nodes/view/263498
2021-09 Statement of revenues, expenses, and changes in net position variance report | State...
Date: September 2021 | Collection: Travel Information Council | Publication Set: Statement of revenues, expenses, and changes in net position variance report |...
https://scholars.duke.edu/publication/1383363
Scholars@Duke publication: Variance of IQ is partially dependent on deletion type among 1,427...
https://afni.nimh.nih.gov/pub/dist/doc/program_help/find_variance_lines.tcsh.html
AFNI program: find_variance_lines.tcsh
afniprogramfindvariancelines
https://jp.mathworks.com/help/econ/garch.filter.html
filter - Filter disturbances through conditional variance model - MATLAB
This MATLAB function returns the numeric arrays of conditional variance paths V and response paths Y from filtering the numeric array of disturbance paths Z...
filterdisturbancesconditionalvariancemodel
https://arxiv.org/abs/2203.10991
[2203.10991] Minimum Variance Unbiased N:M Sparsity for the Neural Gradients
Abstract page for arXiv paper 2203.10991: Minimum Variance Unbiased N:M Sparsity for the Neural Gradients
n m
https://ica-proc.copernicus.org/articles/4/25/2021/
ICA-Proc - Remote sensing based on time variance control in configurable area partitioning
https://zagria.blogspot.com/2009/09/?m=0
A Gender Variance Who's Who: September 2009
Essays on trans, intersex, cis and other persons and topics from a trans perspective.......All human life is here.
gender varianceseptember
https://community.fabric.microsoft.com/t5/Desktop/Variance-between-two-measures/m-p/588484/highlight/true
Solved: Variance between two measures - Microsoft Fabric Community
Jan 9, 2019 - Solved: I have a set of data with a Year-Week column. I want to create a couple of measures for This Year QUS and Last Year QUS so I can see the year
microsoft fabricsolvedvariancetwomeasures
https://ceqanet.lci.ca.gov/2020070499/2
Ballentine Vineyards Use Permit Major Modification P18-00382 & Variance P19-00006
ballentinevineyardsusepermitmajor
https://www.jotform.com/form-templates/contractor-safety-variance-request-form
Contractor Safety Variance Request Form Template | Jotform
Collect and review site-specific exception requests with the Contractor Safety Variance Request Form, helping construction and facilities teams document...
contractor safetyvariance requestform templatejotform
https://cran.r-project.org/web/packages/mmbcv/vignettes/mmbcv-intro.html
mmbcv: Bias-corrected sandwich variance for clustered multistate Cox models
biascorrectedsandwichvarianceclustered
https://www.business-standard.com/article/current-affairs/from-nil-to-77-mm-delhi-s-wide-variance-of-rainfall-at-play-on-monday-122071101522_1.html
From nil to 77 mm, Delhi's wide variance of rainfall at play on Monday | Environmental News -...
After a weeklong wait, the much-awaited monsoon instalment finally arrived at Delhi on Monday but with a wide ranging variations - from 0 mm to 77.5 mm - at...
https://www.sog.unc.edu/publications/bulletins/criminal-indictment-fatal-defect-fatal-variance-and-amendment
The Criminal Indictment: Fatal Defect, Fatal Variance, and Amendment | UNC School of Government
This bulletin explores the criminal indictment, focusing on issues of fatal defect, fatal variance, and when the indictment may be amended....
the criminal
https://dare.uva.nl/id/5a5432fe-8c12-422a-b914-1b6c792d121c
UvA DARE | Variance analysis as a method to predict the locus of plasticity at populations of...
https://www.meteosuisse.admin.ch/services-et-publications/publications/publications-scientifiques/peer-reviewed/variance-of-fluctuating-radar-echoes-from-thermal-noise-and-randomly-distributed-scatterers-atmosphere-5-10-3390-atmos5010092.html
Variance of Fluctuating Radar Echoes from Thermal Noise and Randomly Distributed Scatterers,...
https://www.ojp.gov/library/publications/variance-crime-rates-national-state-and-local-contributions
Variance of Crime Rates - National, State, and Local Contributions | Office of Justice Programs
Variance components analysis was used to investigate the relative contribution of local, State, and national forces on variance in Part I crime rates between...
state and localcrime rates
https://nl.mathworks.com/help/stats/anova1.html
anova1 - One-way analysis of variance - MATLAB
This MATLAB function performs one-way ANOVA for the sample data y and returns the p-value.
analysis of varianceone waymatlab
https://it.mathworks.com/help/econ/egarch.html
egarch - EGARCH conditional variance time series model - MATLAB
Use egarch to specify a univariate EGARCH (exponential generalized autoregressive conditional heteroscedastic) model.
time seriesconditionalvariancemodelmatlab
https://stat.ethz.ch/pipermail/r-sig-meta-analysis/2023-February/004418.html
[R-meta] calculate effect size and variance for prepost proportion data
effect sizermetacalculate
https://fantasystrategyguide.com/variance-and-luck-in-fantasy/
Variance and Luck in Fantasy Sports: Separating Skill from Randomness
Randomness is the uninvited co-manager on every fantasy roster. Understanding the difference between variance — the statistical spread of outcomes around an...
fantasy sportsvarianceluckseparatingskill
https://zagria.blogspot.com/2011/02/donna-lee-parsons-1945-2003-recording.html
A Gender Variance Who's Who: Donna Lee Parsons (1945 - 2003) recording supervisor, Chaplin...
Dave Parsons was raised in Boca Raton, Florida. He and his wife, Fish, had three children, and between them authored the South Florida punk ...
https://help.zoho.com/portal/ar/community/topic/add-support-in-reporting-for-displaying-variance-change-columns-when-comparing-periods?page=1
Add Reporting feature to display variance/change columns when comparing periods
When running reports to compare periods (for example, Profit and Loss comparing current year to previous), I would like to be able to display variance columns...
addreportingfeaturedisplay
https://community.smartsheet.com/discussion/89959/variance-formula
Variance Formula - Smartsheet Community
I need assistance creating an formula to compare this months "Accounts Per Day w TOOQL" number vs last months to see if the number has increased or decreased....
varianceformulasmartsheetcommunity
https://ec2-34-250-149-172.eu-west-1.compute.amazonaws.com/web-story/restaurant-variance-analysis-tools-food-cost-calculator/
Restaurant Variance Analysis Tools | Food Cost Calculator - Jelly Blog
Discover how variance analysis tools and food cost calculators help UK restaurants manage volatile ingredient pricing and protect profit margins.
food cost calculatorvariance analysisrestauranttoolsjelly
https://www.prnewswire.com/news-releases/alpha-variance-solutions-certified-by-the-womens-business-enterprise-national-council-301375510.html
Alpha Variance Solutions Certified By the Women's Business Enterprise National Council
/PRNewswire/ -- Alpha Variance Solutions, a Microsoft Gold Partner specializing in retail and professional services implementations, is proud to announce...
certified bythe women
https://zagria.blogspot.com/2009/12/
A Gender Variance Who's Who: December 2009
Essays on trans, intersex, cis and other persons and topics from a trans perspective.......All human life is here.
gender variancedecember
https://zagria.blogspot.com/2016/04/selena-robbins-193-actress.html
A Gender Variance Who's Who: Selena Robbins (193? - ) actress
Selena Robbins, now almost forgotten, had already completed transition when she became involved in the New York cinema-theater underground ...
gender varianceselenarobbinsactress
https://fr.mathworks.com/help/stats/vartest.html
vartest - Chi-square variance test - MATLAB
This MATLAB function returns a test decision for the null hypothesis that the data in vector x comes from a normal distribution with variance v, using the...
chisquarevariancetestmatlab
https://publikationen.bibliothek.kit.edu/110060321
Analysis and modelling of the temperature variance equation in...
of theanalysismodellingtemperaturevariance
https://zagria.blogspot.com/2011/01/inga-langdon-1952-film-maker-artist.html
A Gender Variance Who's Who: Inga Langdon (1952 - ) film-maker, artist, healer.
Chris Langdon was raised in Indiana. His father was a newspaper photographer and he started making Super 8 films while still a teenager. He ...
gender variance
https://online.stat.psu.edu/stat501/lesson/1/1.4
1.4 - What is The Common Error Variance? | STAT 501
Enroll today at Penn State World Campus to earn an accredited degree or certificate in Statistics.
what is thecommon errorvariancestat
https://www.canr.msu.edu/smprv/acronyms_and_prerequisite_programs
Acronyms & Prerequisite Programs - Meat Processing Variance Training
meat processingacronymsprerequisiteprogramsvariance
https://zagria.blogspot.com/2018/10/willi-papevoo-doo-1893-1967-performer.html
A Gender Variance Who's Who: Willi Pape/Voo Doo (1893 - 1967) performer
Willi Pape was raised in the Berlin suburb of Spandau . His father owned a wooden-shoe factory and his mother was a dressmaker. He had sai...
gender variance
https://zagria.blogspot.com/2007/04/what-is-gender-dysphoria.html
A Gender Variance Who's Who: What is Gender Dysphoria?
'Dysphoria' is Greek for discomfort. Some dictionaries list 'fidget' as among its meanings. I quite like the idea of being a gender fidget -...
gender variancewhat isdysphoria
https://impact.ornl.gov/en/publications/a-clock-synchronization-strategy-for-minimizing-clock-variance-at/
A clock synchronization strategy for minimizing clock variance at runtime in high-end computing...
https://zagria.blogspot.com/2015/02/?m=0
A Gender Variance Who's Who: February 2015
Essays on trans, intersex, cis and other persons and topics from a trans perspective.......All human life is here.
gender variancefebruary
https://zagria.blogspot.com/2013/12/some-events-of-year-2013-part-3-spouses.html
A Gender Variance Who's Who: Some Events of the year 2013: Part 3: Spouses, lovers and Family,...
https://zagria.blogspot.com/2015/01/lili-elbe-media-construct.html
A Gender Variance Who's Who: Lili Elbe, media construct
Part I: Einar Wegener, artist Part II: Lili Ilse Elvenes, surgery and womanhood Bibliography Part III: Lili Elbe, media construct T...
gender variancelili elbemediaconstruct
https://zagria.blogspot.com/2020/08/
A Gender Variance Who's Who: August 2020
Essays on trans, intersex, cis and other persons and topics from a trans perspective.......All human life is here.
gender varianceaugust
https://zagria.blogspot.com/2017/12/books-on-gender-variance-in-2017.html
A Gender Variance Who's Who: Books on Gender Variance in 2017
In compiling this list I kept noticing Jessica Kingsley Publishers . Thus they are printing quite a few trans titles, although more advic...
gender variancebooks
https://it.mathworks.com/help/dsp/ref/variance.html
Variance - Variance of input or sequence of inputs - Simulink
The Variance block computes the unbiased variance of each row or column of the input, or along vectors of a specified dimension of the input.
varianceinputsequencesimulink
https://able2know.org/topic/178504-1
Probability & Statistics : Frequency Function, Expected Value (Mean) & Variance
Question Tagged: Statistics Probability, Replies: 1
probability statisticsexpected valuefrequencyfunctionmean
https://pardonmeforasking.blogspot.com/2011/12/at-yesterdays-bsa-hearing-on-gowanus.html
Pardon Me For Asking: At Yesterday's BSA Hearing On Gowanus Whole Foods Variance
https://scholarworks.iu.edu/dspace/items/288918f7-896c-49d5-9530-2d77044e31e6/full
Accounting for Variance in Concussion Tolerance Between Individuals: Comparing Head Accelerations...
Researchers have been collecting head impact data from instrumented football players to characterize the biomechanics of concussion for the past 15 years, yet...
accountingvarianceconcussion
https://www.coursera.org/projects/budget-analyze-variance-google-sheets?authMode=signup
Build a Budget and Analyze Variance using Google Sheets
Complete this Guided Project in under 2 hours. By the end of this project, you will be able to build a simple budget using Google Sheets. You will be able ...
build a budgetanalyzevarianceusinggoogle
https://zagria.blogspot.com/2014/04/?m=0
A Gender Variance Who's Who: April 2014
Essays on trans, intersex, cis and other persons and topics from a trans perspective.......All human life is here.
gender varianceapril
https://ceqanet.lci.ca.gov/2021040242
Variance TWW-2021-TR-00290 to Allow the Transport of Treated Wood Waste under Alternate Procedures...
2021040242 - 2021-04-09 - NOE - Variance TWW-2021-TR-00290 to Allow the Transport of Treated Wood Waste under Alternate Procedures by JFS Enterprises
https://ia600603.us.archive.org/7/items/zagria.blogspot.com_202101/zagria.blogspot.com/2008/10/elizabeth-r-moberly-196-theologian.html%40showComment%3D1262241607051.html
A Gender Variance Who's Who: Elizabeth R. Moberly (196? - ) theologian.
Moberly is a theologian and self-proclaimed psychoanalyst. She thinks that the primary cause of homosexuality is the failure of bonding with...
gender varianceelizabethmoberlytheologian
https://zagria.blogspot.com/2020/05/abby-sinclair-1938-performer.html
A Gender Variance Who's Who: Abby Sinclair (1938 - ) performer
Sinclair was raised in Flatbush, Brooklyn. By age 14 Sinclair was starting to be perceived as gender variant, and at age 17 left home and f...
gender varianceabbysinclairperformer
https://gns3.teachable.com/courses/routing-configuration-router-administration/lectures/6544919
S4L15 Config EIGRP with Variance Command | GNS3 Academy
configeigrpvariancecommandacademy
https://learn.microsoft.com/en-us/archive/blogs/ericlippert/exact-rules-for-variance-validity
Exact rules for variance validity | Microsoft Learn
exactrulesvariancevaliditymicrosoft
https://docs.amd.com/r/2022.2-English/Vitis_Libraries/quantitative_finance/methods/portfolio_optimisation.html_2
Global Minimum Variance Portfolio - Global Minimum Variance Portfolio - 2022.2 English
The Global Minimum Variance Portfolio is the asset weight distribution that minimizes the variance (risk) of the overall portfolio. It can be calculated as:...
globalminimumvarianceportfolioenglish
https://www.ojp.gov/ncjrs/virtual-library/abstracts/interpretation-variance-forensic-data
Interpretation Variance from Forensic Data
This article examines the potential of a spatial-temporal method for analysis of forensic shoeprint data.
interpretationvarianceforensicdata
https://fr.mathworks.com/help/stats/anova.plotcomparisons.html
plotComparisons - Interactive plot of multiple comparisons of means for analysis of variance...
This MATLAB function creates an interactive plot of the mean responses for each value of the factor in a one-way anova object with comparison intervals.
multiple comparisonsinteractiveplotmeansanalysis
https://zagria.blogspot.com/2014/09/?m=0
A Gender Variance Who's Who: September 2014
Essays on trans, intersex, cis and other persons and topics from a trans perspective.......All human life is here.
gender varianceseptember
https://lists.wikimedia.org/hyperkitty/list/mediawiki-l@lists.wikimedia.org/thread/SHLS7A4SINGQOXJZ4ZMTJSL3WZN2OUQO/
Time stamp variance?? - MediaWiki-l - lists.wikimedia.org
time stampvariancemediawikilwikimedia
https://www.canr.msu.edu/smprv/proper_amount_of_nitrite
Proper Amount of Nitrite - Meat Processing Variance Training
meat processingproperamountnitritevariance
https://zagria.blogspot.com/2021/02/diana-thomas-1959-journalist-editor.html
A Gender Variance Who's Who: Diana Thomas (1959 - ) journalist, editor, novelist
David Thomas Senior, UK diplomat, was posted in Moscow when his son was born. The boy partly grew up in Havana and Washington, DC on later ...
gender variancediana thomas
https://www.canr.msu.edu/resources/417-6-inadequate-haccp-systems
417.6 Inadequate HACCP Systems - Meat Processing Variance Training
An HACCP system may be inadequate based on several factors that are listed in this document.
haccp systemsmeat processinginadequatevariancetraining
https://journals.plos.org/ploscompbiol/article?id=10.1371/journal.pcbi.1009659
Efficient ReML inference in variance component mixed models using a Min-Max algorithm | PLOS...
Author summary Mixed models have been a cornerstone of the quantitative genetics methodology for decades. Due to the growing size of datasets, their associated...
https://se.mathworks.com/help/econ/estimation-with-equality-constraints.html
Conditional Variance Model Estimation with Equality Constraints - MATLAB & Simulink
Constrain the model during estimation using known parameter values.
conditionalvariancemodelestimationequality
https://au.mathworks.com/help/econ/gjr.html
gjr - GJR conditional variance time series model - MATLAB
Use gjr to specify a univariate GJR (Glosten, Jagannathan, and Runkle) model.
time seriesgjrconditionalvariancemodel
https://ia800309.us.archive.org/27/items/zagria.blogspot.com_202101/zagria.blogspot.com/2008/12/whatever-happened-to-pussy-katt-1929.html
A Gender Variance Who's Who: Whatever happened to Pussy Katt (1929 - ).
Steve Clayton was born in Dayton , Ohio. He moved to San Francisco, took the name Pussy Katt, lied about his age and started work as a fem...
whatever happened togender variancepussy katt
https://zagria.blogspot.com/2018/08/helen-savage-1955-vicar-archeologist.html
A Gender Variance Who's Who: Helen Savage (1955 - ) vicar, archeologist, wine columnist
Part I: Life Part II: PhD thesis Mark Savage was born in Barrow , Cumbria, one of three children of a Baptist minister, and was raised i...
gender variance
https://community.smartsheet.com/discussion/119069/formula-variance-help
Formula Variance Help - Smartsheet Community
Good Afternoon. I am looking to set a Baseline Start and End date; however, I have several Phases that I would like to include to capture the change in phases....
formulavariancehelpsmartsheetcommunity
https://www.nyc.gov/site/dep/news/1003b/notice-public-hearing
Academy Express LLC applied for a variance from section 24-163 of the Administrative Code, which...
https://variance.unil.ch/
Variance
variance
https://variancejournal.org/
Variance
Variance (ISSN 1940-6452) is a peer-reviewed journal published by the Casualty Actuarial Society
variance
https://conservancy.umn.edu/items/e1a39cae-9274-4bd3-a831-5f2f84d4b4e4
Methodologies in Dimension Reduction and Error Variance Estimation of High-dimensional Regressions
This thesis discusses several methodologies in dimension reduction and error variance estimation of high-dimensional regression models. The models of interest...
dimension reduction
https://www.mis.mpg.de/events/event/an-optimal-variance-estimate-in-stochastic-homogenization
An optimal variance estimate in stochastic homogenization in Colloquium of the Max Planck...
https://discovery.fiu.edu/display/pub279429
Barndorff-Nielsen and Shephard model: oil hedging with variance swap and option
nielsenshephardmodel
https://zagria.blogspot.com/2013/06/east-new-jersey-in-1960s.html
A Gender Variance Who's Who: East New Jersey in the 1960s
Vito Russo , who would later write the ground-breaking The Celluloid Closet , was raised in East Harlem, Manhattan. In 1961 when he was 15...
gender variancenew jerseyin the
https://publikationen.bibliothek.kit.edu/29702002
On the assumption of constant variance in regression models wi...
on theassumptionconstantvarianceregression
https://ceqanet.lci.ca.gov/2001101027
Conditional Use Permit #01-0009/Variance #01-0006
2001101027 - 2001-10-02 - NEG - Conditional Use Permit #01-0009/Variance #01-0006
conditional use permitvariance
https://ia800309.us.archive.org/27/items/zagria.blogspot.com_202101/zagria.blogspot.com/2009/02/christine-chappel-1972-2000-electrical.html
A Gender Variance Who's Who: Christine Chappel (1972 - 2000) electrical goods retailer.
Bryan Hooley was born in Perth, Western Australia. After moving to the UK he studied electronic engineering at Salford University . He ma...
gender variance
https://zagria.blogspot.com/2008/10/alan-lucill-hart-1890-1962-doctor.html?m=0
A Gender Variance Who's Who: Alan Lucill Hart (1890 - 1962) doctor, roentgenologist, novelist.
Alberta Lucille Hart was raised in rural Oregon by her mother and by a step-father that she did not much like. From an early age she express...
https://data.mendeley.com/datasets/76tcp84j87/1
Data for: Application of a Simple Variance Maximization Technique to MOPITT CO Column Data, and...
These 10 attached datasets are what underly the data in the paper "Lin C., Cohen J.B., Wang S., and Lan R. (2020) "Application of a Combined Standard Deviation...
https://de.mathworks.com/help/dsp/ref/dsp.movingvariance-system-object.html
dsp.MovingVariance - Moving variance - MATLAB
The dsp.MovingVariance System object computes the moving variance of the input signal along each channel, independently over time.
dspmovingvariancematlab
https://ccpah.cpc.unc.edu/resources/publications/bib/17875/
Propensity Score Weighting and Trimming Strategies for Reducing Variance and Bias of Treatment...
https://zagria.blogspot.com/2014/05/indian-trans-women-tell-drivers-to.html
A Gender Variance Who's Who: Indian trans women tell drivers to fasten their seatbelt
Essays on trans, intersex, cis and other persons and topics from a trans perspective.......All human life is here.
https://acp.copernicus.org/articles/23/4045/2023/acp-23-4045-2023-metrics.html
ACP - Metrics - Dependency of vertical velocity variance on meteorological conditions in the...
Abstract. Measurements of vertical velocity from vertically pointing Doppler lidars are used to derive the profiles of normalized vertical velocity variance....
https://scholarworks.gsu.edu/items/fd12cebd-9058-498c-b854-d69b9ee269e0
"They Need Labels": Contemporary Institutional and Popular Frameworks for Gender Variance
needlabelscontemporaryinstitutional
https://zagria.blogspot.com/2022/01/paul-b-preciado-1970-philosopher.html
A Gender Variance Who's Who: Paul B Preciado (1970 - ) philosopher
Preciado, born in Burgos in northen Spain was raised and educated as Beatriz, and having earned a Fulbright Fellowship, at the age of 28 and...
gender variancepaul bphilosopher
https://trailhead.salesforce.com/pt-BR/trailblazer-community/feed/0D54S00000A7YD8SAN
Can I show Variance horizontally | Salesforce Trailblazer Community
I need to compare this year V last year, this mth V this mth last year etc and show the variance in this format Jan 2012 Jan 2013
can ishowvariancehorizontallysalesforce
https://wiki.php.net/rfc/parameter-no-type-variance
PHP: rfc:parameter-no-type-variance
no typephprfcparametervariance
https://zagria.blogspot.com/2025/07/?m=0
A Gender Variance Who's Who: July 2025
Essays on trans, intersex, cis and other persons and topics from a trans perspective.......All human life is here.
gender variancejuly
https://digitalcollections.library.oregon.gov/nodes/view/161358
2017-12 Reduced oxygen packaging without a variance | State Library of Oregon Digital Collections
Date: December 2017 | Collection: Health Authority | Publication Set: Reduced oxygen packaging without a variance | Read the full record details for State...
state library of oregon
https://ia600603.us.archive.org/7/items/zagria.blogspot.com_202101/zagria.blogspot.com/2009/02/elizabeth-tudor-1533-1603-queen.html%40showComment%3D1371146672959.html
A Gender Variance Who's Who: Elizabeth Tudor (1533 - 1603) queen.
The original Elizabeth was the daughter of Henry Tudor (known as Henry VIII) and Anne Boleyn . When she was three, her mother was executed ...
gender varianceelizabethtudorqueen
https://budget.hawaii.gov/budget/variance-report-fiscal-year-2014-2015/
Variance Report, Fiscal Year 2014 and 2015 | Department of Budget and Finance
Organization of the Variance Report The Program Structure Definition of Terms Summary of Expenditure Variances DETAILS OF VARIANCES Economic Development...
fiscal yeardepartment ofvariancereport
https://www.mdpi.com/2073-4360/14/14/2880
The Variance of Photophysical Properties of Tetraphenylethene and Its Derivatives during Their...
The study of aggregation-induced emission luminogens (AIEgens) shows promising perspectives explored in lighting, optical sensors, and biological therapies....
varianceproperties
https://pacman.cs.tsinghua.edu.cn/~zjd/publication/generated/dblp-confppopp-zheng-ztwyjsc-22/
Vapro: performance variance detection and diagnosis for production-run parallel applications |...
detection and diagnosisfor productionvaproperformancevariance
https://fraser.stlouisfed.org/title/finance-economics-discussion-series-1491/estimated-variance-seasonally-adjusted-series-722768
Finance and Economics Discussion Series, Estimated Variance of Seasonally Adjusted Series, 2002-015...
For model-based seasonal adjustment, there are explicit formulas for obtaining the variance of the seasonal factors or the seasonally adjusted series. For...
finance and economicsdiscussion series
https://openresearch.surrey.ac.uk/esploro/outputs/journalArticle/Exemplar-variance-supports-robust-learning-of/99876764902346
Exemplar variance supports robust learning of facial identity - University of Surrey
Differences in the visual processing of familiar and unfamiliar faces have prompted considerable interest in face learning, the process by which unfamiliar...
exemplarvariancesupportsrobustlearning
https://zagria.blogspot.com/2019/06/gloria-swanson-1906-1940-performer.html?m=0
A Gender Variance Who's Who: Gloria Swanson (1906 - 1940) performer.
Original version: October 2010 Walter Winston was born in Atlanta, Georgia. His family, like many other African Americans, moved north t...
gender variancegloria swansonperformer
https://stat.ethz.ch/pipermail/r-sig-meta-analysis/2021-August/003158.html
[R-meta] clubSandwich for variance components
rmetaclubsandwichcomponents
https://pennsylvaniaplumbingauthority.com/pennsylvania-plumbing-variance-and-appeals/
Requesting a Plumbing Code Variance or Appeal in Pennsylvania
Pennsylvania property owners, licensed contractors, and building officials operating under the state's Uniform Construction Code UCC encounter situations where...
plumbing coderequestingvarianceappealpennsylvania