Robuta

https://www.sicaventures.com/ Sica Ventures - Capital & Advisory Sica Ventures is an early stage investment company based in Columbus, OH and the DC Metro area. ventures capitalsicaadvisory https://www.bdevventures.com/ BDEV Ventures | Capital + Lead Generation May 22, 2026 - We invest venture capital and our Lead Generation Platform to accelerate Growth for B2B Startups. ventures capitalleadgeneration https://hawkeyeprivateventures.com/ Hawkeye Private Ventures - Private Capital for Real Estate Investors Hawkeye Private Ventures is a dynamic corporation with specialized divisions offering tailored Business Financial Solutions, Innovative Software, CRM... ventures capitalreal estatehawkeyeprivateinvestors https://www.quantumventures.vc/ Quantum Ventures | Capital, network, and synergies Made with Softr, the easiest way to turn your data into internal tools and client portals. No coding required. ventures capitalquantumnetworksynergies https://www.richhennessey.com/ RichHennessey.com | New Ventures / Capital Sourcing new venturescapitalsourcing https://veteranventures.us/ Veteran Ventures Capital — Built for This Market Defense and national security investment firm backing veteran-led dual-use technology companies. $100M AUM, 16 portfolio companies, $250M+ in non-dilutive... ventures capitalveteranbuiltmarket https://kabcoventures.shop/ Kabco Ventures | Capital & Strategic Growth ventures capitalstrategicgrowth https://www.pxnventures.co.uk/ PXN Ventures | Venture Capital & Investment for the North Nov 24, 2025 - PXN Ventures is the leading venture capital firm for the North of England, Scotland, and NI. We provide "more than money" support to high-growth founders. ventures venture capitalpxninvestmentnorth https://octopusventures.com/ Octopus Ventures | Venture Capital Mar 12, 2026 - We provide venture capital investment for the people, ideas and industries that will change the world. Learn about what we do and the kind of founders we back. ventures ventureoctopuscapital https://menlovc.com/ Menlo Ventures | Early-Stage Venture Capital Firm Dec 9, 2025 - Menlo Ventures is an early-stage venture capital firm that invests across AI, consumer, enterprise, and healthcare technologies. ventures early stagemenlocapitalfirm https://www.av.vc/ Invest in Startups | Venture Capital Access for Individuals | Alumni Ventures - Alumni Ventures Access curated startup investment opportunities and diversified venture capital exposure designed for accredited investors. venture capitalinveststartupsaccessindividuals https://cleanenergyventures.com/ Clean Energy Ventures | Climate Tech Venture Capital Mar 18, 2026 - Clean Energy Ventures invests in scalable early-stage climate tech startups and clean energy technologies addressing global climate change. climate tech ventureclean energyventurescapital https://resilientventures.org/ Resilient Ventures – Expanding Access To Capital for African Americans expanding accessresilientventurescapitalafrican https://6thman.ventures/ 6th Man Ventures | Builder-First Capital 6MV is a thesis-driven crypto focused investment firm backing the world's most tenacious founders. manventuresbuilderfirstcapital https://www.goldengate.vc/ Golden Gate Ventures | Venture Capital for Southeast Asia Golden Gate Ventures is a global, early-stage venture capital firm that empowers audacious founders across 3 continents. Founded in 2011, Golden Gate Ventures... ventures venture capitalgolden gatesoutheastasia https://www.arboretumvc.com/ Midwest Healthcare Venture Capital Firm | Arboretum Ventures Mar 31, 2026 - For over 20 years we have been a successful healthcare venture capital firm rooted in the Midwest. Check out our portfolio companies. venture capital firmmidwesthealthcarearboretumventures https://www.vccircle.com/btomorrow-ventures-multipoint-capital-invest-in-ai-solutions-firm-paralleldots Btomorrow Ventures, Multipoint Capital invest in AI solutions firm ParallelDots Artificial intelligence startup ParallelDots, which offers advanced image recognition solutions, on Monday said it has raised a Series A funding of... capital investai solutionsventuresmultipointfirm https://goalventurepartners.com/ Goal Ventures | Venture Capital for Games and Digital Media ventures venture capitalgoalgamesdigitalmedia https://www.finsmes.com/2025/04/saison-capital-bri-ventures-coinvestasi-launches-tokenize-indonesia-a-rwa-startup-accelerator.html Saison Capital, BRI Ventures & Coinvestasi Launches Tokenize Indonesia - a RWA Startup Accelerator May 7, 2025 - Saison Capital, BRI Ventures, and Coinvestasi have officially launched Tokenize Indonesia, a new accelerator program aimed at identifying and supporting... saisoncapitalbriventureslaunches https://hashgraphvc.com/ Hashgraph Ventures | AI & Blockchain Venture Capital ventures aihashgraphblockchaincapital https://www.rachelzoeventures.com/ Rachel Zoe Ventures | Venture Capital | West Hollywood Rachel Zoe Ventures is an early stage venture capital firm focused on disruptive consumer technology platforms and solutions. ventures venture capitalrachel zoewesthollywood https://www.yamahamotor.vc/ Yamaha Motor Ventures | Global Venture Capital Firm in Silicon Valley Yamaha Motor Ventures is investing in early stage startups that are changing the world of Mobility, AgTech, and HealthTech. global venture capitalyamaha motorventuresfirmsilicon https://pwv.com/ PWV | Early stage capital for technology founders | Preston-Werner Ventures PWV (Preston-Werner Ventures) is a Silicon Valley venture capital firm led by Tom Preston-Werner. We back category-defining companies from zero to breakout. early stagecapitaltechnologyfounderspreston https://idventures.com/ ID Ventures - Early-Stage Capital from Invest Detroit Mar 12, 2026 - ID Ventures scales promising early-stage ventures into thriving companies that help support the state’s economy, provide jobs to local talent, and bolster... ventures early stageidcapitalinvestdetroit https://www.arthurventures.com/ Arthur Ventures | Early Growth Capital Firm | Arthur Ventures Arthur Ventures is an early growth capital firm that leads investments in B2B software companies in every region of the U.S. and Canada. ventures earlygrowth capitalarthurfirm https://baincapitalventures.com/insight/why-we-re-doubling-down-on-maintainx/ Why We’re Doubling Down on MaintainX | Bain Capital Ventures Dec 15, 2025 - MaintainX is reimagining industrial workflows for the AI era and is fast becoming the system of record for physical operations. bain capitaldoublingmaintainxventures https://rhiaventures.org/rhcapital/ RH Capital - Rhia Ventures rh capitalrhiaventures https://citizensventures.com/projects Citizens Ventures — Building cities with citizens, capital, and trust Citizens Ventures brings together local citizens, structured capital, and turnkey development projects to support the long-term growth of cities worldwide. citizens venturesbuilding citiescapitaltrust https://baincapitalventures.com/team/tom-dotan/ Tom Dotan | Strategic Team Member & Results-Driven Pro | Bain Capital Ventures Discover Tom Dotan, a results-driven professional focused on impact and collaboration. Learn how Tom can support your goals—connect with him today. team memberresults drivenbain capitaltomdotan https://www.beyondcapitalventures.com/ Beyond Capital Ventures beyond capitalventures https://citizensventures.com/cities/tijuana Citizens Ventures — Building cities with citizens, capital, and trust Citizens Ventures brings together local citizens, structured capital, and turnkey development projects to support the long-term growth of cities worldwide. citizens venturesbuilding citiescapitaltrust https://industryventures.durkancloud.net/ Industry Ventures - Collaborative and Innovative Venture Capital Platform Mar 3, 2025 - Industry Ventures has cultivated new segments of the venture capital market for over two decades using its complete lifecycle approach. venture capitalindustryventurescollaborativeinnovative https://baincapitalventures.com/insight/the-answer-to-our-it-service-desk-woes-moveworks/ Moveworks + ServiceNow: AI ITSM acquisition news | Bain Capital Ventures Apr 20, 2026 - Discover how Moveworks and ServiceNow transform ITSM with AI-driven ticket resolution. Learn more about the acquisition and see what’s next. ai itsmacquisition newsbain capitalmoveworksservicenow https://altventures.ca/ ALT VENTURES – Canada's Top Pre-Seed Venture Capital Firm for Entrepreneurs & Communities venture capital firmtop prealtventurescanada https://www.onehundred.vc/ Creativity is the future of capital | One Hundred Ventures If you've built something worth copying, we make sure you get paid when they do. One Hundred is an IP firm and venture studio that protects, monetizes, and... capital onecreativityfuturehundredventures https://citizensventures.com/about About Citizens Ventures | Citizen Capital Network Learn about the Citizen Capital Network—a democratic economic funding model enabling local citizens to participate in structured growth capital for real... citizens venturescapitalnetwork https://venturecapitalcareers.com/companies/cvx-ventures CVX Ventures | Venture Capital Careers CVX is one of Europe's fastest growing venture investors and is executing on our path to become Europe’s largest venture investor by providing high growth... ventures venture capitalcvxcareers https://adirvc.com/ Adir Ventures - Venture Capital, Private Equity, Seed Investing Venture capital, Private Equity, and Seed Investing. ventures venture capitalprivate equityadirseedinvesting https://tiventures.ch/ Ti-Ventures – High-Tech seed capital Venture Capital – Lugano, Switzerland high techtiventuresseedcapital https://aprilvc.com/ April Ventures - Pre-Seed Capital Ventures Firm ventures pre seedaprilcapitalfirm https://www.fog.ventures/ FOG Ventures | Venture Capital FOG connects founders with operator investors who deliver customers, talent, and strategic advisory. Over 3,000 introductions made to help startups scale. ventures venturefogcapital https://freeflow.zone/ FreeFlow Ventures — Execution First. Capital After. We diagnose what is broken in your startup, fix it with you, and connect you to capital only after proof. first capitalfreeflowventuresexecution https://citizensventures.com/cities/seoul Citizens Ventures — Building cities with citizens, capital, and trust Citizens Ventures brings together local citizens, structured capital, and turnkey development projects to support the long-term growth of cities worldwide. citizens venturesbuilding citiescapitaltrust https://www.enlightenedcapitalventures.biz/ Enlightened Capital Ventures – RE Investment Company capital venturesenlightenedinvestmentcompany https://www.lumiraventures.com/login/ Login - Lumira Ventures | Venture Capital Life Sciences | Canada lumira ventures venturecapital life sciencescanada https://psymed.ventures/ PsyMed Ventures - Frontier Brain and Mental Health Venture Capital Fund Mar 7, 2026 - We are a venture fund investing in frontier brain and mental health: neurotech, precision psychiatry, novel therapeutics, digital therapeutics, holistic... mental healthventure capitalventuresfrontierbrain https://venturecapitalcareers.com/companies/thomson-reuters-ventures/jobs/summer-analyst-corporate-venture-capital-fund-internship Summer Analyst, Corporate Venture Capital Fund Internship at Thomson Reuters Ventures • New York,... Thomson Reuters Ventures is hiring a Summer Analyst, Corporate Venture Capital Fund Internship in New York, United States - Apply now on Venture Capital... corporate venture capitalthomson reuterssummeranalystfund https://citizensventures.com/projects/franchises Citizens Ventures — Building cities with citizens, capital, and trust Citizens Ventures brings together local citizens, structured capital, and turnkey development projects to support the long-term growth of cities worldwide. citizens venturesbuilding citiescapitaltrust https://www.magmatic.ventures/index.html MAGMATIC VENTURES - Venture Capital für Start-ups Magmatic Ventures bietet Venture Capital Finanzierung für Start-ups und unterstützt Gründer mit Netzwerk und Know-how. ventures venture capitalstartups https://www.prnewswire.com/news-releases/collaborative-robotics-raises-30m-series-a-backed-by-sequoia-capital-khosla-ventures-and-mayo-clinic-launches-flywheel-program-301885727.html COLLABORATIVE ROBOTICS RAISES $30M SERIES A BACKED BY SEQUOIA CAPITAL, KHOSLA VENTURES, AND MAYO... Jul 26, 2023 - /PRNewswire/ -- Collaborative Robotics, a leader in the development of practical collaborative robots (cobots), today announced it has raised $30M in Series... collaborative roboticsraisesseriesbackedsequoia https://www.questventures.com/businesses/venture-capital/ Venture Capital - Quest Ventures Aug 14, 2024 - Driving the digital economy across Asia. Quest Ventures back early-stage companies and is usually the catalyst they need to disrupt their industry. venture capitalquestventures https://www.baeventures.com/en/how-we-work/our-approach/ Our Approach - How We Work - BAE Ventures - Venture Capital ventures ventureapproachworkbaecapital https://www.av.vc/institutional Institutional Capital & Alumni Ventures - Alumni Ventures institutionalcapitalalumniventures https://growthventures.capitalone.com/ Home | Capital One Ventures Capital One Ventures is a strategic investor, harnessing the potential of startups to accelerate innovation. capital oneventures https://www.kensho.vc/ Kensho Ventures | European Deep-Tech Venture Capital European deep-tech VC. EUR 500K first checks, hands-on infrastructure from Day 1. Investing in robotics, cybersecurity, quantum, and industrial AI. european deep techkenshoventurescapital https://mobilityventures.com/ Mobility Ventures | Venture Capital for Disruptive Technology Startups ventures venture capitaldisruptive technologymobilitystartups https://www.agmcapitalventures.com/ ACCESS | AGM Capital Ventures We deliver value through thoughtful site selection, disciplined execution, and a strong alignment with investor objectives. Our leadership brings more than... accessagmcapitalventures https://baincapitalventures.com/newsletter/ Newsletter | Bain Capital Ventures Bain Capital Ventures helps founders build iconic businesses that transform the way we live and work. bain capitalnewsletterventures https://www.nextbold.vc/ Next Bold Ventures - Operational Capital for Bold Visions Jan 25, 2023 - Next Bold Ventures invests and provides operational expertise to founders to turn bold ideas into great companies across Asia Pacific. nextboldventuresoperationalcapital https://baincapitalventures.com/insight/these-are-2024s-top-50-vertical-saas-startups/ Top 50 Vertical SaaS Startups to Watch in 2024 | Bain Capital Ventures Apr 20, 2026 - Discover 2024’s top 50 vertical SaaS startups transforming AEC, logistics, legal and finance with AI. Explore the list and find your next partner. vertical saasbain capitaltopstartupswatch https://capitallab-ventures.com/ Capital Lab Ventures | Venture Capital capitallabventures https://baincapitalventures.com/team/abby-meyers/ Abby Meyers: Growth Stage Software Investor | Bain Capital Ventures Meet Abby Meyers, investor in growth stage application software across the US and Europe. Discover her approach to founders and investing today. growth stagebain capitalabbymeyerssoftware https://citizensventures.com/how-it-works Citizens Ventures — Building cities with citizens, capital, and trust Citizens Ventures brings together local citizens, structured capital, and turnkey development projects to support the long-term growth of cities worldwide. citizens venturesbuilding citiescapitaltrust https://www.graphitevc.com/philosophy/ Our focus in Canada's venture capital | Graphite Ventures Oct 20, 2025 - We are specialists at seed stage growth, helping founders build capital-efficient businesses that scale. Learn why we are the most trusted seed vc in Canada venture capitalfocuscanadagraphiteventures https://menlovc.com/focus-areas/cybersecurity/ Menlo Ventures | Cybersecurity Venture Capital Firm Feb 16, 2026 - Menlo Ventures, a leading cybersecurity venture capital firm, partners with early-stage startups developing innovative, AI-native security solutions. menlo venturescybersecuritycapitalfirm https://www.venturesplatform.com/stories/venture-capital-as-a-catalyst-driving-africas-transformation-through-investment-in-innovation Ventures Platform | Venture Capital as a Catalyst: Driving Africa’s Transformation Through... ventures platformcapitalcatalystdrivingtransformation https://www.vanterra.com/ Vanterra | Ventures & Capital Vanterra is a multi-strategy investment fund that manages assets for a diverse investor base of ultra-high net worth partners and leading institutions. vanterraventurescapital https://menlovc.com/focus-areas/infrastructure/ Menlo Ventures | Infrastructure Venture Capital Firm Feb 16, 2026 - Menlo Ventures invests in the infrastructure that powers AI and the cloud. We provide capital, guidance, and expertise to help infrastructure startups achieve... menlo venturesinfrastructurecapitalfirm https://www.aiconicventures.com/ AI & Deep Tech Venture Capital | AICONIC VENTURES Nov 10, 2025 - AICONIC VENTURES is an AI and deep tech venture capital firm investing in the latest tech innovations. Connect with us to scale your breakthrough idea. ai deep techventure capitalventures https://vcwire.tech/2026/04/23/pegasus-tech-ventures-and-japanet-extend-corporate-venture-capital-fund-to-us200m/ Pegasus Tech Ventures and Japanet Extend Corporate Venture Capital Fund to US$200M Apr 23, 2026 - Pegasus Tech Ventures, a global venture capital firm focused on startup investments and corporate innovation, expanded its corporate venture capital (CVC) fund... corporate venture capitaltech venturespegasusextendfund https://capitalmarketventures.com/ About - Capital Market Ventures Oct 27, 2023 - Mr. Darwin J. Bruce is a business leader, author, speaker, and corporate lawyer. Check out his book "The Map to Entrepreneurship: Your Complete Guide To Being... capital marketventures https://tcvegypt.com/ TCV - Tanmiya Capital Ventures Jun 30, 2025 - Tanmiya Capital Ventures (“TCV”), founded in 2016, is an Egypt-based investment management firm specializing in growth equity investments guided by impact tcvcapitalventures https://citizensventures.com/cities/tokyo Citizens Ventures — Building cities with citizens, capital, and trust Citizens Ventures brings together local citizens, structured capital, and turnkey development projects to support the long-term growth of cities worldwide. citizens venturesbuilding citiescapitaltrust https://www.tysonfoods.com/innovation/food-innovation/tyson-ventures Tyson Ventures: Our Food Venture Capital Firm | Tyson Foods Tyson Ventures is the venture capital firm of Tyson Foods changing the food industry through food technology, emerging sources of protein and sustainable... venture capital firmtysonventuresfood https://vesaliusventures.com/ A venture capital firm created for diversified investments | Vesalius Ventures Vesalius Ventures is a venture capital firm dedicated to accelerating the future of medicine by becoming the premier conduit for enabling technologies that... venture capital firmcreateddiversifiedinvestmentsvesalius https://blackcapitalventures.com/ Black Capital Ventures – High Tech Startup Advisory Partner capital ventureshigh techstartup advisoryblackpartner https://cjrcapitalventures.com/ CJR Capital Ventures, LLC - Multifamily Syndication CJR Capital Ventures, LLC is a rеаl еѕtаtе invеѕtment аnd рrореrtу mаnаgеmеnt соmраnу with a fосuѕ оn multifаmilу properties. capital venturescjrllcmultifamilysyndication https://baincapitalventures.com/domain/app/ AI Apps: Agentic AI for High-Impact Productivity | Bain Capital Ventures Discover how AI apps and agentic AI transform workflows, boost productivity, and power tech-enabled services. Learn more and start building today. ai appshigh impactbain capitalagenticproductivity https://longevity.technology/news/longevity-technology-and-and-capital-ventures-launch-partnership/ Longevity.Technology and AND Capital Ventures launch partnership May 5, 2026 - Strategic market intelligence partnership connects Longevity.Technology’s DLT platform with AND Capital’s operator-led investment strategy. capital ventureslongevitytechnologylaunchpartnership https://aurumcapitalventures.com/ Aurum Capital Ventures | #1 Provider for institutional Hashrate Investment Mar 19, 2026 - Aurum Capital Ventures is a pioneer in the modular data center industry, providing forward-thinking investors with secure access to this emerging space capital venturesaurumproviderinstitutionalhashrate https://baincapitalventures.com/domain/healthcare/ AI-Powered Healthcare: Transparent, Personalized Care | Bain Capital Ventures Discover how AI-powered healthcare transforms access, cuts costs, and improves outcomes with transparent, personalized care. Explore the future of health. ai powered healthcarebain capitaltransparentpersonalizedventures https://baincapitalventures.com/team/nicole-lorusso/ Nicole Falasco: Apps Go-to-Market & Growth Partner | Bain Capital Ventures Discover how Nicole Falasco helps apps portfolio companies scale with strategic buyer, channel and acquirer relationships. Connect to grow faster. market growthbain capitalnicoleappsgo https://eandiventuresllc.com/ E and I Ventures – Capital and Counselling for Early Stage and Startup Technology Firms early stage startupventurescapitalcounsellingtechnology https://backswingventures.com/ Defense & National Security Venture Capital | Backswing Ventures Mar 19, 2026 - An early-stage venture firm investing in defense and national security technologies, backing founders building mission-critical companies. defense national securityventure capitalventures https://ammpcapital.com/ Private Investment Firm Backing High-Growth Ventures | AMMP Capital AMMP Capital is a purpose-driven investment firm supporting founders and scaling ventures across real estate, consumer, health, and tech. private investment firmhigh growthbackingventuresammp https://www.gr33nbase.io/ GR33NBASE | Access to & Capital for GreenTech Funds and Ventures We leverage regulated digital assets and token economic principles to mobilize private capital and broaden access to the promising asset class of greentech... accesscapitalgreentechfundsventures https://baincapitalventures.com/insight/vc-insights-2025-ai-trends-startup-growth-and-2026-predictions/ VC Insights 2025: AI Trends, Startup Growth and 2026 Predictions | Bain Capital Ventures Dec 18, 2025 - Bain Capital Ventures partners reflect on this year's biggest shifts, market surprises, and what they think is coming next in 2026. ai trendsstartup growthbain capitalvcinsights https://baincapitalventures.com/domain/industrial/ Industrials: Modern Hardware, Software & AI | Bain Capital Ventures Discover how modern hardware, software and AI drive an industrial renaissance with robotics, automation and reshored supply chains. Learn more today. hardware softwarebain capitalindustrialsmodernventures https://sawariventures.com/ Sawari Ventures – Leading Venture Capital in Egypt leading venturesawariventurescapitalegypt https://bbvaventures.com/ BBVA Ventures — Next-Gen Crypto Prop Trading Hub | Capital, Risk Protection & AI Trading... BBVA Ventures is a high-performance crypto proprietary trading platform offering funded accounts, real-time analytics, institutional risk protection,... next gencrypto proprisk protectionbbvaventures https://fsdafrica.org/backing-african-ventures-what-will-it-take-to-shift-the-balance-of-capital/ Backing African Ventures: What will it take to Shift the Balance of Capital? - FSD Africa May 13, 2026 - L – R: Alex Ramnyika from the Uganda National Social Security Fund, Evah Kimani from Britam Micro Insurance, Abishkar Shrestha from Visa Foundation, Kento... backingafricanventurestakeshift https://web3.capital/careers-1 Web3 Capital | Web3 Ventures | Web3 DAO | Web3 Accelerator Web3 Capital | Web3 Ventures | Web3 DAO | Web3 Accelerator capital venturesdaoaccelerator https://88capitalventures.com/ 88 Capital Ventures Venture capital firm investing in transformative technology companies capitalventures https://www.lumiraventures.com/fr-ca/home-francais/ Home - Français - Lumira Ventures | Venture Capital Life Sciences | Canada lumira ventures venturecapital life sciencescanada https://lfbventures.com/capital-advisory/ Capital Advisory - LFB Ventures capital advisorylfbventures https://lfxvp.com/ LFX Ventures - A global venture capital firm focused on investing in the future of supply chain and... We focus on investing in cutting-edge technologies and disruptive business models in Manufacturing, Logistics, and Commerce Enablement that drive innovation in… global venture capitalfirm focusedsupply chainlfxventures https://doenventures.com/news/foamlab-raises-3m-eur-growth-capital-to-build-pilot-plant-and-scale-bio-based-foams/ Foamlab raises 3m EUR growth capital to build pilot plant and scale bio-based foams - DOEN Ventures growth capitalpilot plantbio basedraiseseur