https://pubmed.ncbi.nlm.nih.gov/40964122/
Low birth weight is positively associated with dementia risk. Cardiometabolic diseases in middle-aged adults may mediate the relationship between low birth...
low birth weightdementia riskassociationlarge
https://www.natureworldnews.com/articles/60041/20231227/alcohol-use-vitamin-d-deficiency-elevates-risk-young-onset-dementia.htm
One's risk of young-onset dementia could increase due to alcohol use and Vitamin D deficiency. Read more here.
young onset dementiaalcohol userisktriggeredvitamin
https://kffhealthnews.org/morning-breakout/45-of-dementia-cases-linked-to-14-modifiable-risk-factors-study/
Among the factors are cataracts, glaucoma, age-related macular degeneration, nearsightedness, and farsightedness. An estimated 5% to 19% of U.S. dementia cases...
modifiable risk factorsdementiacaseslinked
https://pubmed.ncbi.nlm.nih.gov/15066068/
Consumption of up to three servings of wine daily is associated with a lower risk of AD in elderly individuals without the APOE epsilon-4 allele.
alcoholintakeriskdementia
https://www.jpost.com/health-and-wellness/health-and-wellness-around-the-world/article-837997
Consuming at least a quarter serving of processed meat daily, like two bacon slices or one hot dog, significantly raises dementia risk.
hot dogsdementia riskreplacingfishcuts
https://pubmed.ncbi.nlm.nih.gov/37182375/
Urban tree canopy is associated with lower dementia risk, but no mediation analysis has been attempted to reveal potential mechanisms. We examined 3,639...
urban treedementia riskmightcanopyreduce
https://www.sciencealert.com/shockingly-common-injury-linked-with-increased-dementia-risk
Older adults who experience injurious falls are more likely to develop dementia within a year of their accident compared to people of the same age who have...
dementia riskcommoninjurylinkedincreased
https://alzheimer.ca/en/about-dementia/how-can-i-reduce-risk-dementia/brain-healthy-tips-reduce-your-risk-dementia?gclid=Cj0KCQiA5vb-BRCRARIsAJBKc6LwA8pHsB0Iwi52EKR5
This page lists evidence-based tips and strategies to help you lead a healthy, balanced lifestyle that reduces your risk of dementia.
healthy tipsbrainreduceriskdementia
https://www.the-independent.com/life-style/health-and-families/dementia-alzheimers-symptoms-high-fat-cheese-b2890086.html
Dec 24, 2025 - The new findings may sound like welcome news, but they need careful interpretation
dementia risktwofoodscouldreduce
https://www.weforum.org/stories/2018/02/positive-attitudes-about-aging-reduce-risk-of-dementia-in-older-adults/
A new study suggests that people who live in cultures with more positive beliefs about ageing have a lower risk of developing dementia.
positiveageingcouldlowerrisk
https://www.kgun9.com/its-so-az/dementia-risk-reduction-starts-earlier-than-you-think-according-to-pima-county-health-department
Pima County Health Department wants Southern Arizonans to know how people can reduce their risk of Dementia by applying these simple steps
dementia riskreductionstartsearlierthink
https://www.iasp-pain.org/publications/pain-research-forum/papers-of-the-week/paper/198676-trigeminal-neuralgia-dementia-risk-factor-retrospective-cohort-study/
: Dementia, a worldwide public-health issue, is regarded as a disorder rather than a normal aging process. Trigeminal neuralgia (TN) is a chronic debilitating...
trigeminal neuralgiadementia riskretrospective cohortfactor
https://www.tribuneindia.com/news/health/frailty-depression-in-older-adults-may-together-account-for-17-per-cent-of-dementia-risk-study/
Frailty and depression should be routinely assessed in older people, as improving their physical and mental health could help reduce dementia risk.
older adultsfrailtydepressionmaytogether
https://case.edu/medicine/about/newsroom/our-latest-news/popular-diabetes-and-weight-loss-drug-may-reduce-risk-dementia
Researchers at the Case Western Reserve School of Medicine have found that semaglutide, a popular diabetes and weight-loss drug, may lower the risk ...
weight loss drugreduce riskpopulardiabetesmay
https://www.sciencealert.com/theres-one-critical-thing-you-can-do-to-cut-your-risk-of-dementia
Jan 13, 2026 - Inside the body, a 24-hour rhythm, known as the circadian rhythm, quietly coordinates when we sleep, wake, eat, and recover.
onecriticalthing
https://pubmed.ncbi.nlm.nih.gov/19439724/
The late-life dementia risk index accurately stratified older adults into those with low, moderate, and high risk of developing dementia. This tool could be...
older adultslate lifepredictingriskdementia
https://www.news-medical.net/news/20231120/Sugary-drinks-linked-to-higher-dementia-risk-new-study-from-UK-Biobank-reveals.aspx
The study finds that consuming free sugars, especially through beverages like fruit drinks, sodas, and milk-based drinks, is associated with an increased risk...
sugary drinksdementia risknew studylinkedhigher
https://www.thehealthy.com/news/study-young-onset-dementia-risk-factors/
Younger-onset dementia affects an estimated 110 out of every 100,000 people, and having these health conditions can increase your odds.
risk factorsstudycouldleaddementia
https://www.sciencefocus.com/news/17-risk-factors-stroke-dementia-depression
Think of this like a menu for a long, healthy and happy life
simple wayslowerriskstrokedementia
https://sciencedaily.com/releases/2022/05/220512092701.htm
People who have been hospitalized for a major traumatic brain injury (TBI) may have a higher risk of developing dementia when compared to people who do not...
study findsincreasedriskdementiahospitalization
https://www.womenshealthmag.com/food/a69895103/high-fat-cheese-prevent-dementia/
Jan 2, 2026 - A study of 27,670 Swedish participants suggests the role of dietary fats—including saturated fats from certain foods—in brain health should be reconsidered.
high fatstudyeatingcheeselinked
https://www.sciencetimes.com/articles/27320/20200916/ptsd-identified-risk-factor-developing-dementia.htm
Researchers from University College London identify post-traumatic stress disorder as a risk factor of dementia. The team continues to research other risk...
risk factorptsdidentifieddevelopingdementia
https://www.jpost.com/health-and-wellness/health-and-wellness-around-the-world/article-837993
The scientists concluded that the antioxidant and anti-inflammatory properties of green tea might protect blood vessels and promote brain health.
three cupsgreen teadrinkingdailymay
https://www.thehealthy.com/alzheimers/news-magnesium-and-dementia-risk-public-health-study/
A new study finds the connection between magnesium and dementia risk. Here's how enjoying a bite of dark chocolate can be a no-brainer.
increasingintakemineralcouldlower
https://www.frontiersin.org/journals/medicine/articles/10.3389/fmed.2017.00166/full
Cognitive disorders represent a leading cause of disability in the aging population, of which dementia has the highest global burden. Early signs of dementia...
motoric cognitive riskfrontierssyndromepredictordementia
https://thekiwisocial.com/story4918335/about-dementia-fall-risk
dementiafallrisk
https://www.medicalnewstoday.com/articles/both-too-much-and-too-little-sleep-associated-with-signs-of-dementia-stroke?utm_source=ReadNext
Feb 6, 2024 - Recent research based on UK Biobank data has found that suboptimal sleep is associated with biomarkers of dementia and stroke in the brain.
dementia risksleeplengthaffect
https://www.thestar.com.my/lifestyle/family/2025/11/28/childhood-loneliness-may-increase-dementia-risk-later-in-life
A team of doctors based in Australia, China and the United States has found evidence that the effects of early-life loneliness are not limited to childhood,...
dementia riskchildhoodlonelinessmayincrease
https://www.24horas.cl/english/science/listening-music-reduce-dementia-risk-study-finds
Study finds music listening and playing may cut dementia risk and improve memory in adults over 70.
dementia riskmusiclinkedlowerseniors
https://medicaldialogues.in/oncology/news/hormone-therapy-for-breast-cancer-linked-with-lower-dementia-risk-study-132536
Hormone modulating therapy (HMT) used for the treatment of breast cancer was associated with a 7% lower risk of developing Alzheimer's disease and related...
hormone therapybreast cancerdementia risklinkedlower
https://www.cnn.com/2025/11/29/health/exercise-midlife-dementia-risk-wellness
Nov 29, 2025 - High physical activity in midlife and late life is linked with a significantly lower risk for dementia, a new study has found.
dementia riskexercisemidlifelinkedlower
https://www.firehouse.com/safety-health/news/21148028/studies-world-trade-center-responders-at-risk-for-dementia
Studies led by Stony Brook University researchers have found that World Trade Center responders show a higher risk for developing Alzheimer's disease or...
world trade centerstudiesrespondersriskdementia
https://www.newsmax.com/health/dr-crandall/atrial-fibrillation-dementia-dr-crandall/2023/07/26/id/1128620/
A procedure to restore normal heart rhythm is more effective than medications for reducing dementia risk in people with the heart rhythm disorder atrial...
dementia riskafibtreatmentreducesnewsmax
https://www.cbsnews.com/news/popular-afib-heart-drug-warfarin-linked-to-dementia-risk/
Study finds the heart rhythm disorder afib and one of its common treatments may impact brain health
heart drugdementia riskpopularafibwarfarin
https://www.goodrx.com/conditions/dementia/dementia-prevention-diet
Dementia prevention diets, such as the Mediterranean and MIND diets, can affect your dementia risk. Learn more about these diets and why they work with GoodRx.
dementia preventionbest optionslower riskdietgoodrx
https://www.thestar.com.my/lifestyle/health/2025/12/27/these-high-fat-foods-could-help-cut-dementia-risk
Researchers have found that regular consumption of cheese and cream is associated with a lower risk of developing dementia.
high fatdementia riskfoodscouldhelp
https://www.news-medical.net/news/20250319/Experimental-drug-shows-promise-in-reducing-risk-of-Alzheimers-related-dementia.aspx
An experimental drug appears to reduce the risk of Alzheimer's-related dementia in people destined to develop the disease in their 30s, 40s or 50s, according...
experimental drugreducing riskshowspromisealzheimer
https://www.sharecare.com/healthy-aging/dementia/air-pollution-dementia-risk
Exposure to air pollution, particularly from wildfires and agriculture, is tied to a greater risk for dementia. Learn why and how to protect yourself.
air pollutionmayincreaseriskdementia
https://www.healthywomen.org/your-health/dementia-patients-greater-risk-covid-19
By Michael S. Jaffee, University of Florida and Steven DeKosky, University of FloridaNew research is shedding light on how dementia can increase people's risk...
dementiapatientsgreaterriskcovid
https://www.sciencedaily.com/releases/2012/09/120927185916.htm
Patients over the age of 65 who begin taking benzodiazepine (a popular drug used to treat anxiety and insomnia) are at an approximately 50 percent increased...
increasedriskdevelopingdementiabenzodiazepine
https://www.natureworldnews.com/articles/21702/20160506/atrial-fibrillation-warfarin-use-increase-risk-dementia.htm
New study reveals that long term Warfarin treatment of patients suffering from atrial fibrillation have a higher risk of developing dementia, such as...
atrial fibrillationwarfarinusepatientslinked
https://newatlas.com/medical/vitamin-d-deficiency-dementia-risk/
University of South Australia scientists have found a link between vitamin D deficiency and an increased risk of dementia and stroke. The study found that a...
dementia riskvitamindeficiencylinkedincreased
https://www.thehealthy.com/ear-nose-throat/hearing-loss/news-hearing-aids-and-dementia-john-hopkins-university/
Recent findings from a Johns Hopkins study have opened up a promising avenue for possibly delaying cognitive decline with hearing aids.
dementia risknew studywearingmayreduce
https://www.frontiersin.org/journals/aging-neuroscience/articles/10.3389/fnagi.2022.985109/full
Objectives: To investigate whether Non-alcoholic Fatty Liver Disease (NAFLD) increases the risk of dementia or cognitive impairment.Methods: PubMed, EMBASE, ...
cognitive impairmentnon alcoholicfrontiersriskdementia
https://www.news-medical.net/news/20250722/GLP-1-receptor-agonists-linked-to-lower-dementia-risk-in-type-2-diabetes.aspx
GLP-1 receptor agonists, a class of drug used to treat type 2 diabetes, likely trump the widely prescribed metformin for curbing dementia risk in people with...
receptor agonistsdementia riskglplinkedlower
https://bestlifeonline.com/dementia-risk-factors-over-45/
A new Canadian study identified the 12 biggest dementia risk factors if you're 45 or older. Researchers advise focusing on the biggest four to reduce your risk...
dementia riskbiggestfactors
https://www.mindbodygreen.com/articles/for-lower-dementia-risk-keep-your-heart-healthy-study-sacys-the-sooner-the-better
For this study, researchers wanted to look into whether the age of coronary heart disease onset impacted Alzheimer's and dementia risk later on.
dementia riskheart healthylowerkeepstudy
https://www.alzheimers.org.uk/about-dementia/managing-the-risk-of-dementia/reduce-your-risk-of-dementia?ref=genxbackpacker.com
There are things you can do to reduce your own risk of developing dementia. These include keeping active, eating healthily and exercising your mind.
reduceriskdementiaalzheimersociety
https://www.phillyvoice.com/dementia-risk-early-menopause-estrogen-/
Early menopause increases a woman's risk for dementia by 35%, a new study found. Low estrogen levels may be one of the reasons for this increased risk. The...
dementia riskearly menopausewomen studyfactorsincreases
https://carleton.ca/news/story/hearing-loss-and-dementia/
Imola MacPhee, a Carleton University researcher, is using brain imaging to reveal how hearing loss increases your risk of dementia.
hearing lossaudibilityagingbrainsincreases
https://www.nationalgeographic.com/health/article/social-frailty-and-dementia-study
Nov 20, 2025 - Scientists are studying the effect of “social frailty” on memory loss—and testing whether AI companions can help.
social tiesdementia riskweakerlinkedincreased
https://www.thehealthy.com/alzheimers/vaccine-significantly-reduces-dementia-risk-says-stanford-study/?int_campaign=tmb_trend_recirc&int_source=direct&int_medium=tmb.com&int_placement=single_card
Receiving this vaccine could lower your risk of dementia by as much as 20%, and doctors already recommend it for adults over 50 years old.
stanford studynewsurprisingvaccinecould
https://www.pharmacytimes.com/view/2003-02-7103
Pharmacy Times offers the latest news and insights for the pharmacy professional and solutions that impact the everyday practice of pharmacy.
dementia riskcholesterolmaylinkedpharmacy
https://mn.gov/deaf-commission/news/?id=1063-600268
Free admission. Please join us in learning out this important topic on a critical issue for our deaf, deafblind, and hard of hearing community.
join usrisk factorsdementiaamongdeaf
https://www.technologynetworks.com/neuroscience/news/mars-bound-astronauts-face-chronic-dementia-risk-galactic-cosmic-ray-exposure-284633
Study raises questions about long-term brain health after extended spaceflights.
dementia riskmarsboundastronautsface
https://www.hindustantimes.com/lifestyle/health/triple-dementia-risk-associated-with-multiple-heart-related-conditions-research-101654840515216.html
Within this study population, the researchers found that the more of these three conditions a person had, the higher their risk of dementia. People who had all...
dementia riskrelated conditionstripleassociatedmultiple
https://www.advisory.com/daily-briefing/2022/05/11/risk-factors
A new study published Monday in JAMA Neurology identified eight risk factors that were linked to 36.9% of Alzheimer's cases and related dementia in the United...
risk factorslinkednearlyalzheimer
https://www.pharmacytimes.com/view/study-finds-no-evidence-that-hormone-therapy-use-affects-dementia-risk-in-postmenopausal-women
Recent research reveals no link between menopause hormone therapy and dementia risk, urging further studies to clarify its effects on cognitive health.
study findshormone therapyevidenceuseaffects
https://neurosciencenews.com/loneliness-dementia-neurology-27908/
A large meta-analysis of over 600,000 people shows that experiencing loneliness significantly raises the risk of developing dementia by 31%.
dementia riskneuroscience newslonelinessincreases
https://www.healthday.com/health-news/caregiving/dementia-caregivers-themselves-at-higher-risk-for-brain-aging
Dementia Caregiver Risks: Study shows caregivers face higher risk of brain aging due to lifestyle factors like smoking and poor sleep.
brain agingdementiacaregivershigherrisk
https://www.alzheimers.org.uk/about-dementia/managing-the-risk-of-dementia/additional-treatments-for-dementia-risk/hormones
Dementia affects more women than men and it is thought that hormones may play a role in this.
dementia riskhormonesalzheimersociety
https://www.cbsnews.com/video/how-hearing-aids-may-decrease-the-risk-of-dementia/
More than six million older Americans are living with dementia. A new study suggests that hearing aids may help slow cognitive decline. CBS News chief medical...
hearing aidsmaydecreaseriskdementia
https://www.sciencealert.com/one-stage-of-sleep-seems-to-be-critical-in-reducing-dementia-risk
The risk of getting dementia may go up as you get older if you don't get enough slow-wave sleep.
onestagesleepseemscritical
https://www.news-medical.net/news/20250825/Having-a-sense-of-purpose-linked-to-lower-dementia-risk.aspx
Research into Blue Zones - regions of the world where people tend to live longer - shows that having a sense of purpose in life may help people live longer.
dementia risksensepurposelinkedlower
https://www.helsinki.fi/en/news/mental-health/psychological-symptoms-middle-age-may-increase-risk-dementia
According to a recently completed study, the risk of dementia is one-fifth higher in people who report more perceived stress or depression, nervousness or...
middle agepsychologicalsymptomsmayincrease
https://www.mindbodygreen.com/articles/study-reveals-seven-health-factors-decrease-risk-of-dementia-48704a
A study reveals that there are seven health factors that may affect your likelihood of developing dementia down the line. Here's what they are.
studyrevealshealthfactorshelp
https://www.techtarget.com/pharmalifesciences/news/366608104/Long-Term-Air-Pollution-Exposure-Increases-Dementia-Risk
A study in JAMA Internal Medicine found that exposure to PM2.5 from varying sources impacted the risk of developing dementia.
long termair pollutiondementia riskexposureincreases
https://www.the-express.com/news/health/188902/dementia-risk-music-every-day
Nov 2, 2025 - New research has found that one simple task can reduce your risk of dementia by 39% - and it's something that many people do every day without even realizing it
onesimplehabiteverydayreduce
https://share.transistor.fm/s/8922696f
Join Kosta and his guest: Dr. Mitchell Clionsky, Board-Certified Clinical Neuropsychologist, Clinician and Co-Author of Dementia Prevention: Using Your Head to...
long term careneverstrategykosta
https://www.chroniclelive.co.uk/news/health/dementia-risk-could-increase-you-32523218
Sep 22, 2025 - A study has revealed that higher fat levels around the abdomen or arms were associated with an increased risk of conditions including dementia and...
dementia riskbelly fatcouldincrease
https://www.sciencedaily.com/releases/2009/07/090708181153.htm
People who have superior language skills early in life may be less likely to develop Alzheimer's disease decades later, despite having the hallmark signs of...
language skillstwentiesmaypredictrisk
https://www.huffpost.com/entry/listening-to-music-every-day-lower-dementia-risk_l_69308b68e4b02cf3b175c7b6
Dec 4, 2025 - “It engages multiple brain areas at once, acting like a full-brain workout,” experts say.
every daystudyrevealslisteningmusic
https://www.medicalnewstoday.com/articles/high-levels-troponin-heart-damage-biomarker-middle-age-increased-dementia-risk
Nov 11, 2025 - People with signs of heart damage during middle age — detected through a specific protein — are at a higher risk of developing dementia later in life, a...
dementiabiomarkerheartdamagemay
https://www.technologynetworks.com/neuroscience/news/flu-pneumonia-vaccinations-tied-to-lower-risk-of-alzheimers-and-dementia-new-reported-research-337919
Flu (influenza) and pneumonia vaccinations are associated with reduced risk of Alzheimer's disease, according to new research reported.
lower riskflupneumoniavaccinationstied
https://www.medicalnewstoday.com/articles/physical-activity-at-2-life-stages-may-help-lower-dementia-risk
Nov 24, 2025 - People who stay physically active throughout middle age as well as later in life could lower their risk of dementia, a new paper based on Framingham heart...
physical activitydementialifetimecouldinfluence
https://sciencedaily.com/releases/2023/07/230705171104.htm
Older people who have fluctuating levels of cholesterol and triglycerides may have a higher risk of Alzheimer's disease and related dementias compared to...
levelscholesteroltriglycerideslinkedincreased
https://www.elsevier.es/en-revista-european-journal-psychiatry-431-articulo-an-alzheimer-s-dementia-cumulative-risk-S0213616322000817
Background and objectivesWith the population ageing, the identification of modifiable risk
cumulative riskalzheimerdementiamodelsample
https://www.news-medical.net/news/20240925/Increasing-daily-consumption-of-flavonoid-rich-foods-may-lower-dementia-risk.aspx
Research shows that flavonoid-rich diets, including tea and red wine, are associated with a lower risk of dementia in genetically susceptible individuals.
rich foodsincreasingdailyconsumptionflavonoid
https://www.miragenews.com/body-clocks-linked-to-dementia-risk-1596990/
Highlights:A new study has found circadian rhythm, the body's internal clock, may affect a person's risk of dementia.More than 2,000 people wore
dementia riskbodyclockslinkedmirage
https://www.bswhealth.com/blog/how-to-lower-your-risk-of-dementia-with-lifestyle-changes
Do you fear aging? With the prevalence of dementia increasing, many people fear getting old. Thanks to medical advancements, our bodies are living lon...
lifestyle changesafraiddementialowerrisk