Robuta

https://www.cipsm.de/publications/research-area-c/molecular-basis-of-rna-polymerase-iii-transcription-repression-by-maf1/ CIPSM - Molecular Basis of RNA Polymerase III Transcription Repression by Maf1 rna polymerasemolecularbasis https://pubchem.ncbi.nlm.nih.gov/protein/B1J4N3 DNA-directed RNA polymerase subunit omega (Pseudomonas putida W619) | Protein Target - PubChem Protein target information for DNA-directed RNA polymerase subunit omega (Pseudomonas putida W619). Find diseases associated with this biological target and... rna polymerase https://pka-inhibitor-fragment-6-22-amide.com/index.php?g=Wap&m=Article&a=detail&id=16434 T7 RNA Polymerase: Unlocking Next-Gen RNA Therapeutics an... rna polymerasenext genunlockingtherapeutics https://pure.psu.edu/en/publications/negative-elongation-factor-nelf-coordinates-rna-polymerase-ii-pau/ Negative elongation factor (NELF) coordinates RNA polymerase II pausing, premature termination, and... rna polymerase https://www.wikidata.org/wiki/Q15335000 DNA-directed 5'-3' RNA polymerase activity - Wikidata Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed... rna polymerasednadirectedactivitywikidata https://www.ncbi.nlm.nih.gov/protein/6UU4_EEE Chain EEE, DNA-directed RNA polymerase subunit omega - Protein - NCBI rna polymerasechaineeednadirected https://scholars.uky.edu/en/publications/interaction-of-rna-polymerase-with-forked-dna-evidence-for-two-ki/ Interaction of RNA polymerase with forked DNA: Evidence for two kinetically significant... rna polymerase https://www.sdbonline.org/sites/fly/genebrief/pol2.htm RNA polymerase II 215kD subunit rna polymeraseii https://reactome.org/content/detail/R-HSA-76042 Reactome | RNA Polymerase II Transcription Initiation And Promoter Clearance Reactome is pathway database which provides intuitive bioinformatics tools for the visualisation, interpretation and analysis of pathway knowledge. rna polymerasereactomeiitranscriptioninitiation https://www.idtdna.com/page/support-and-education/decoded-plus/what-does-rna-polymerase-do What does RNA polymerase do? | IDT Aug 22, 2025 - What does RNA polymerase do? Discover how it is used to transcribe the information in DNA on to RNA molecules. rna polymeraseidt https://pubchem.ncbi.nlm.nih.gov/protein/C1DC35 DNA-directed RNA polymerase subunit omega (Laribacter hongkongensis HLHK9) | Protein Target -... Protein target information for DNA-directed RNA polymerase subunit omega (Laribacter hongkongensis HLHK9). Find diseases associated with this biological target... rna polymerasednadirected https://asc-j9.com/index.php?g=Wap&m=Article&a=detail&id=14966 T7 RNA Polymerase: High-Specificity Enzyme for In Vitro R... rna polymerasein vitrohighspecificityenzyme https://pediaa.com/difference-between-dna-and-rna-polymerase/ Difference Between DNA and RNA Polymerase | Definition, Replication, Transcription, Process Dec 6, 2017 - What is the difference between DNA and RNA Polymerase? DNA polymerase synthesizes the entire chromosome. RNA polymerase stops the synthesis at transcription dna and rnadifference betweenpolymerasedefinitionreplication https://pubchem.ncbi.nlm.nih.gov/protein/Q8MAI8 DNA-directed RNA polymerase subunit alpha (Elymus hystrix) | Protein Target - PubChem Protein target information for DNA-directed RNA polymerase subunit alpha (Elymus hystrix). Find diseases associated with this biological target and compounds... rna polymerasednadirected https://www.next-gen-rna.com/shop/mbs9468505-rna-polymerase-beta-rabbit-mab-160339 RNA polymerase beta Rabbit mAb | Next Generation RNA rna polymerasebetarabbitmabnext https://www.molecularstaging.com/shop/mbs8543547-rna-polymerase-beta-rabbit-pab-266889 RNA Polymerase beta Rabbit pAb | Molecular Staging rna polymerasebetarabbitpabmolecular https://d-tek.be/en/products/antigen/28-rna-polymerase-iii.html RNA Polymerase III - D-tek rna polymeraseiiitek https://pubchem.ncbi.nlm.nih.gov/protein/Q2MI69 DNA-directed RNA polymerase subunit alpha (tomato) | Protein Target - PubChem Protein target information for DNA-directed RNA polymerase subunit alpha (tomato). Find diseases associated with this biological target and compounds tested... rna polymerasednadirectedalphatomato https://www.ncbi.nlm.nih.gov/protein/6X4W_H Chain H, DNA-directed RNA polymerase subunit alpha - Protein - NCBI rna polymerasechaindnadirectedalpha https://www.selleckchem.com/products/cx-5461-pidnarulex-rna-polymerase-i-inhibitor.html CX-5461 (Pidnarulex) | RNA Polymerase I Inhibitor | CAS 1138549-36-6 | Selleck Chemicals CX-5461 is a potent small-molecule rRNA synthesis inhibitor with an IC50 of 0.11 μM. Find all the information about CX-5461 for cell signaling research. https://www.pombase.org/gene/SPBC725.17c PomBase - protein coding gene - rrn11 (SPBC725.17c) - RNA polymerase I general transcription... PomBase - protein coding gene - rrn11 (SPBC725.17c) - RNA polymerase I general transcription initiation factor subunit Rrn11 - The Schizosaccharomyces pombe... https://db.cngb.org/data_resources/gene/68360026 HRG_10898 reverse transcriptase (RNA-dependent DNA polymerase) domain-containing protein [... CNGBdb is an unified platform built for biological big data sharing and application services to the research community. Based on the big data and cloud... reverse transcriptasedna polymerasehrgrna https://pascal-francis.inist.fr/vibad/index.php?action=getRecordDetail&idt=5149850 A purified adenovirus 289-amino-acid E1A protein activates RNA polymerase III transcription in... https://www.cusabio.com/Recombinant-Protein/Recombinant-Human-TAF6-like-RNA-polymerase-II-p300CBP-associated-factor-associa-945557.html Recombinant Human TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa... Purchase Recombinant Human TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L (TAF6L). It is produced in Yeast. High... https://experts.arizona.edu/en/publications/synthesis-of-the-putative-red-clover-necrotic-mosaic-virus-rna-po/ Synthesis of the putative red clover necrotic mosaic virus rna polymerase by ribosomal... https://orlaproteins.com/antibody/polr2e-dna-directed-rna-polymerases-i-ii-and-iii-subunit-rpabc1-dna-directed-rna-polymerase-ii-23kd-polypeptide-dna-directed-rna-polymerase-ii-subunit-e-rpb5-homolog-xap4/ POLR2E (DNA-directed RNA Polymerases I, II, and III Subunit RPABC1, DNA-directed RNA Polymerase II... POLR2E (DNA-directed RNA Polymerases I, II, and III Subunit RPABC1, DNA-directed RNA Polymerase II 23kD Polypeptide, DNA-directed RNA Polymerase II Subunit E,... https://experts.llu.edu/en/publications/heterogeneity-in-mllaf-4-fusion-messenger-rna-detected-by-the-pol-2/ Heterogeneity in MLL/AF-4 Fusion Messenger RNA Detected by the Polymerase Chain Reaction in t(4;11)... https://www.sbsgenetech.com/store/products/dna-free-t7-rna-polymerase DNA-Free T7 RNA Polymerase DNA-Free T7 RNA Polymerase is a DNA-dependent RNA polymerase encoded by the T7 bacteriophage, used for in vitro RNA synthesis. It has high specificity for the... dnafreernapolymerase https://investigadores.uandes.cl/en/publications/the-reactivity-of-sulfhydryl-groups-of-yeast-dna-dependent-rna-po/ The reactivity of sulfhydryl groups of yeast DNA dependent RNA polymerase I - Universidad de los... https://researchexperts.utmb.edu/en/publications/high-fidelity-of-yellow-fever-virus-rna-polymerase/ High Fidelity of Yellow Fever Virus RNA Polymerase - UTMB Health Research Expert Profiles yellow fever virus https://www.yeastrc.org/pdr/viewGONode.do?acc=GO:0021918 YRC Public Data Repository - Gene Ontology - regulation of transcription from RNA polymerase II... The YRC PDR provides for the searching of millions of protein descriptions from many databases to find proteins and public experimental data describing those... https://kazuma-okd.com/publications/nakagawa2017molecular/ Molecular function analysis of rabies virus RNA polymerase L protein by using an L gene-deficient... Jan 1, 2017 - Kazuma Okada - Virologist, CiDER, The University of Osaka https://discovery.dundee.ac.uk/en/publications/emkluyveromyces-lactisem-zymocin-mode-of-action-is-linked-to-rna-/fingerprints/ emKluyveromyces lactis/em zymocin mode of action is linked to RNA polymerase II function via... https://experts.colorado.edu/display/pubid_18467 Molecular Architecture of the Human Mediator-RNA Polymerase II-TFIIF Assembly | CU Experts | CU... https://www.ncbi.nlm.nih.gov/nuccore/3N4M_D Chain D, E. coli RNA polymerase alpha subunit C-terminal domain in com - Nucleotide - NCBI https://www.ncbi.nlm.nih.gov/Structure/pdb/8UKQ 8UKQ: RNA polymerase II elongation complex with Fapy-dG lesion in apo state DNA-directed RNA polymerase II subunit RPB1DNA-directed RNA polymerase II subunit RPB11DNA-directed RNA polymerase II subunit RPB2DNA-directed RNA polymerase... https://www.ncbi.nlm.nih.gov/Structure/pdb/4EE1 4EE1: The structure of the S. aureus DnaG RNA Polymerase Domain bound to CTP and Manganese DNA primaseBENZAMIDINECYTIDINE-5'-TRIPHOSPHATEMANGANESE (II) ION https://www.preprints.org/manuscript/202509.1143 Development of RNA Aptamers that Inhibit the RNA-dependent RNA Polymerase Activity of SARS-CoV-2... The continuous emergence of SARS-CoV-2 variants with enhanced transmissibility and immune escape capability highlights the urgent need for mutation-independent... https://pubchem.ncbi.nlm.nih.gov/protein/Q92H89 DNA-directed RNA polymerase subunit omega (Rickettsia conorii str. Malish 7) | Protein Target -... Protein target information for DNA-directed RNA polymerase subunit omega (Rickettsia conorii str. Malish 7). Find diseases associated with this biological... https://www.igmm.cnrs.fr/en/publication/rna-polymerase-ii-ctd-is-dispensable-for-transcription-and-required-for-termination-in-human-cells/ RNA polymerase II CTD is dispensable for transcription and required for termination in human cells... https://pubmed.ncbi.nlm.nih.gov/7540285/ RNAII transcribed by IPTG-induced T7 RNA polymerase is non-functional as a replication primer for... RNAII, an RNA species encoded by ColE1-type plasmids, serves as a primer for plasmid DNA replication. Previous work has shown that overproduction of RNAII... https://www.wikidata.org/wiki/Q67576513 Cytokine messenger RNA profiles in inflammatory bowel disease mucosa detected by polymerase chain... scientific article published on 01 November 1992 inflammatory bowel disease https://libgallery.cshl.edu/items/show/32645 FASEB Abstract for "The Subunit Structure of E. coli DNA-Dependent RNA Polymerase: Evidence For Two... Preserving and promoting the history of molecular biology. https://db.cngb.org/data_resources/gene/68360403 HRG_11275 reverse transcriptase (RNA-dependent DNA polymerase) domain-containing protein [... CNGBdb is an unified platform built for biological big data sharing and application services to the research community. Based on the big data and cloud... reverse transcriptasedna polymerasehrgrna https://www.ncbi.nlm.nih.gov/Structure/pdb/1QUV 1QUV: CRYSTAL STRUCTURE OF THE RNA DIRECTED RNA POLYMERASE OF HEPATITIS C VIRUS PROTEIN (RNA-DIRECTED RNA POLYMERASE) crystal structureof the https://urgi.versailles.inrae.fr/faidare/studies/dXJuOkVWQS9zdHVkeS9QUkpOQTQ3NjU4MA== Study : RNA Polymerase II read-through promotes expression of neighboring genes in SAL1-PAP-XRN... https://pmc.ncbi.nlm.nih.gov/articles/PMC342708/ A computer aided oligonucleotide analysis provides a model sequence for RNA polymerase-promoter... A novel computer procedure has been used to search for homology among 17 known procaryotic promoter sequences. A model sequence, :formula: (see text), is... oligonucleotide analysis https://uu.diva-portal.org/smash/record.jsf?pid=diva2:360455 Rate of ribosomal RNA transcription modulated by the rrn operon sequence and RNA polymerase...