Robuta

https://www.epa.gov/research-grants/niehsepa-cehcs-center-integrative-research-childhood-leukemia-and-environment NIEHS/EPA CEHCs: Center for Integrative Research on Childhood Leukemia and the Environment (CIRCLE)... Mar 13, 2026 - Scientists at this center are examining how early exposure to toxic chemicals might contribute to leukemia in children https://leukemia360.org/ LEUKEMIA 360 - November 17, 2026, in Paris leukemianovemberparis https://www.lepaf.org/ The Leukemia Patient Advocates Foundation - LePAF Mar 16, 2026 - The Leukemia Patient Advocates Foundation (LePAF) is a patient-led, charitable non-profit foundation. Its mission is to improve the lives and survival of... patient advocatesleukemiafoundation https://know-aml.com/ Know AML | Acute Myeloid Leukemia awareness initiative Know AML is the first global AML awareness initiative that provides patients, caregivers, and healthcare professionals with information, resources, and support. acute myeloid leukemiaknowamlawarenessinitiative https://globalleukemiaacademy.com/ Home - Global Leukemia Meeting globalleukemiameeting https://know-alleukemia.com/ Know ALL | The first global acute lymphoblastic leukemia awareness initiative Know ALL is the first global ALL awareness initiative that provides patients, caregivers, and healthcare professionals with information, resources, and support. acute lymphoblastic leukemiaknow allthe firstglobalawareness https://euroleuk.com/ 5th European Congress on Controversies in Leukemia | Germany Jul 14, 2026 - EuroLeuk2026 | 5th European Congress on Controversies in Leukemia. Join leading hematology experts in Munich, Germany, 26–27 October, 2026 european congresscontroversiesleukemiagermany https://drum.lib.umd.edu/items/81aea376-f172-4e8e-8dfc-41dbf289900c Metabolism of [1-14C]linoleic acid in human promyelocytic leukemia HL-60 cells grown and... The metabolism of [1-14C]linoleic acid (LA) was studied in human promyelocytic leukemia cell line HL-60, grown and differentiated in serum-free medium. Both... https://pubmed.ncbi.nlm.nih.gov/27373815/ Prevalence and Clinical Significance of FLT3 Mutation Status in Acute Myeloid Leukemia Patients: A... Prevalence of FLT3-ITD mutation in AML was present in a proportion comparable to other populations and, when present, was associated with a very poor prognosis. https://pubmed.ncbi.nlm.nih.gov/15215669/ Story of benzene and leukemia: epidemiologic approach of Muzaffer Aksoy In 1974, Professor Muzaffer Aksoy established a link to leukemia in humans as a result of occupational exposure to benzene. The aim of this study is to... story ofbenzeneleukemiaapproachmuzaffer https://bkoffman.blogspot.com/2009/08/208.html Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman: 208 https://pubmed.ncbi.nlm.nih.gov/39164653/ Application of artificial intelligence in chronic myeloid leukemia (CML) disease prediction and... AI offers groundbreaking insights and tools for enhancing prediction, prognosis, and personalized treatment in chronic myeloid leukemia. Integrated AI systems... chronic myeloid leukemiaartificial intelligence https://www.latimes.com/archives/la-xpm-1986-01-09-mn-14172-story.html Spread of Unusual but Deadly Leukemia Virus in U.S. Feared - Los Angeles Times Jan 9, 1986 - Scientists are worried that a virus that causes an unusual but deadly form of leukemia in widely scattered parts of the world will become a serious problem in... https://pmc.ncbi.nlm.nih.gov/articles/PMC11592599/ Acute Myeloid Leukemia: Diagnosis and Evaluation by Flow Cytometry - PMC Acute myeloid leukemia (AML) is a heterogeneous group of diseases characterized by the clonal proliferation of immature myeloid precursors. The diagnosis and... acute myeloid leukemiadiagnosis and evaluationflow cytometrypmc https://bkoffman.blogspot.com/2010/07/two-year-anniversary.html?showComment=1278101306586 Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman: Two Year... https://www.semanticscholar.org/topic/thymus-leukemia-antigens/326158 thymus-leukemia antigens | Semantic Scholar thymusleukemiaantigenssemanticscholar https://pure.psu.edu/en/publications/impact-of-depth-of-clinical-response-on-outcomes-of-acute-myeloid/ Impact of depth of clinical response on outcomes of acute myeloid leukemia patients in first... acute myeloid leukemia https://www.gofundme.com/f/support-eric-wileys-fight-against-leukemia/donate?_dt=eyJuYW1lIjoiRXJpYyAgV2lsZXkiLCJyb2xlIjoiY28iLCJmdW5kcmFpc2VySWQiOiI4ODAwMTYyNyJ9&modal=profile&source=btn_donate Donate to Support Eric Wiley's Fight Against Leukemia donate to supportericwileyfightleukemia https://kidshealth.org/SeattleCH/en/parents/cml.html Chronic Myelogenous Leukemia (CML) (for Parents) - Seattle Children's Hospital While this type of blood cancer is more common in adults, it affects children, too. Thanks to advances in therapy, most kids with CML can be cured. chronic myelogenous leukemiafor parentscmlseattlechildren https://bkoffman.blogspot.com/2008/11/and-she-shows-you-where-to-look-among.html Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman: "And she... https://researchportal.helsinki.fi/en/publications/janus-kinases-in-leukemia/ Janus Kinases in Leukemia - University of Helsinki university ofjanuskinasesleukemiahelsinki https://www.altus.af.mil/News/Imagery/Photos/igphoto/2002621956/ Seven-year-old boy who beat leukemia becomes a pilot for a day U.S. Air Force Major Jason Heffner, 56th Air Refueling Squadron KC-46 Pegasus instructor pilot, shows Noah Branscum, pilot for a day, the controls inside the... year old https://scholars.lib.ntu.edu.tw/entities/publication/399ea82e-f5d3-47be-979a-d21e442e49da Chemotherapy-Related Side Effects in Children with Acute Lymphocytic Leukemia in Taiwan:A Nursing... acute lymphocytic leukemia https://nrc-publications.canada.ca/eng/view/object/?id=b6b42a7f-48e0-4e99-b312-81e4a8c28802 TNF receptor 2 is essential for RIP1-dependent cell death in refractory leukemia - NRC Publications... TNF receptor 2 is essential for RIP1-dependent cell death in refractory leukemia https://dukespace.lib.duke.edu/items/8a2a9434-5cbb-4fce-9a2d-ec7b4ddac044 Umbilical Cord Blood Transplantation in Children with Acute Leukemia: Impact of Conditioning on... The Blood and Marrow Transplant Clinical Trials Network (BMT CTN 0501) randomized children with hematologic malignancies to transplantation with 1 or 2 cord... umbilical cord blood https://www.cbsnews.com/news/first-of-its-kind-designer-immune-cells-cure-babys-leukemia/ First-of-its-kind immune cell therapy appears to cure baby's leukemia - CBS News For the first time ever, doctors use gene-edited immune cells to treat "incurable" leukemia in little girl first of its kind https://www.mayoclinic.org/diseases-conditions/chronic-lymphocytic-leukemia/care-at-mayo-clinic/mac-20352437 Chronic lymphocytic leukemia - Care at Mayo Clinic - Mayo Clinic Find out more about the symptoms, diagnosis and treatment of this type of leukemia. chronic lymphocytic leukemiacaremayoclinic https://www.endcancer00.com/ Elika Almeida - Leukemia & Lymphoma Society Woman of the Year - Team Elika Find out more about Team Elika LLS Woman of the Year. Woman of the Year is philanthropic competition to support blood cancer research among a group of... woman of the yearleukemia lymphomaelikaalmeidasociety https://bkoffman.blogspot.com/2008/10/yes-were-going-to-party-party-beatles.html Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman: "Yes,... https://infoscience.epfl.ch/entities/publication/07aaf847-ba55-40a9-a064-517da0d3964c Allosteric BCR-ABL inhibitors in Philadelphia chromosome-positive acute lymphoblastic leukemia:... philadelphia chromosomeallostericbcrablinhibitors https://www.latimes.com/archives/la-xpm-1996-01-04-me-20848-story.html Pregnant Women's Drinking Linked to Infant Leukemia : Science File / An exploration of issues and... Jan 4, 1996 - Babies born to women who drink alcohol during the last six months of pregnancy are 10 times more likely to develop leukemia during infancy, Minnesota... https://bkoffman.blogspot.com/2009/11/highs-and-lows.html Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman: Highs... https://www.news-medical.net/news/20220830/Leukemia-drug-successfully-disrupts-HER2-positive-brain-metastasis-in-animal-studies.aspx Leukemia drug successfully disrupts HER2-positive brain metastasis in animal studies Aug 30, 2022 - In animal studies led by researchers at Duke Cancer Institute, a drug approved to treat leukemia successfully disrupted the ability of HER2-positive breast... brain metastasisleukemiadrugsuccessfullydisrupts https://bkoffman.blogspot.com/2013/07/asco-2013-dr-wierda-on-prognostic.html Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman: ASCO... https://publikationen.uni-tuebingen.de/xmlui/handle/10900/90440 Pediatric acute lymphoblastic leukemia-Conquering the CNS across the choroid plexus acute lymphoblastic leukemiathe cnspediatricconqueringacross https://boris-portal.unibe.ch/entities/publication/1c02fcdd-8997-407a-9252-e65ea742b7be WIPI-dependent autophagy during neutrophil differentiation of NB4 acute promyelocytic leukemia... Members of the WD-repeat protein interacting with phosphoinositides (WIPI) family are phosphatidylinositol 3-phosphate (PI3P) effectors that are essential for... wipidependentautophagyneutrophil https://tobias-lib.ub.uni-tuebingen.de/xmlui/handle/10900/83968 T-cell responses against CD19(+) pediatric acute lymphoblastic leukemia mediated by bispecific... acute lymphoblastic leukemia https://pubchem.ncbi.nlm.nih.gov/bioassay/99245 AID 99245 - Effective dose to show cytotoxicity against leukemia MOLT-4 cell line was determined -... BioAssay record AID 99245 submitted by ChEMBL: Effective dose to show cytotoxicity against leukemia MOLT-4 cell line was determined. https://pubmed.ncbi.nlm.nih.gov/32011571/ Neonatal Acute Lymphoblastic Leukemia Acute lymphoblastic leukemia (ALL) in a neonate can have a similar clinical appearance to other serious pathology and should be considered in the ill-appearing... neonatalacuteleukemia https://pmc.ncbi.nlm.nih.gov/articles/PMC45926/ Activation of c-myb is an early bone-marrow event in a murine model for acute promonocytic leukemia... Insertional mutagenesis of c-myb by Moloney murine leukemia virus occurs in 100% of promonocytic leukemias (MMLS) induced by the virus. These leukemias, which... https://pubmed.ncbi.nlm.nih.gov/32127639/?tool=bestpractice.com European LeukemiaNet 2020 recommendations for treating chronic myeloid leukemia The therapeutic landscape of chronic myeloid leukemia (CML) has profoundly changed over the past 7 years. Most patients with chronic phase (CP) now have a... europeanrecommendationstreatingchronicmyeloid https://pt.usc.edu/course/oncology-rehab-for-lymphoma-leukemia-and-multiple-myeloma-2/ Oncology Rehab for Lymphoma, Leukemia and Multiple Myeloma - USC Division of Biokinesiology and... https://www.sciencenews.org/article/leukemia-fighter-drug-could-combat-resistant-cases Leukemia Fighter: Drug could combat resistant cases Aug 8, 2019 - A new drug for treating chronic myeloid leukemia that is resistant to the frontline drug imatinib shows promise in mouse tests. leukemiafighterdrugcouldcombat https://pubchem.ncbi.nlm.nih.gov/bioassay/6808 AID 6808 - Inhibition of rat basophilic leukemia cell 5-lipoxygenase - PubChem BioAssay record AID 6808 submitted by ChEMBL: Inhibition of rat basophilic leukemia cell 5-lipoxygenase. aidinhibitionrat https://www.gofundme.com/f/support-mike-and-carols-journey-through-leukemia/donate?source=btn_donate_update Donate to Support Mike and Carol's Journey Through Leukemia donate to supportmikecaroljourneyleukemia https://www.cancer.gov/publications/dictionaries/cancer-terms/def/acute-lymphoblastic-leukemia Definition of acute lymphoblastic leukemia - NCI Dictionary of Cancer Terms - NCI NCI's Dictionary of Cancer Terms provides easy-to-understand definitions for words and phrases related to cancer and medicine. acute lymphoblastic leukemiadefinition ofncidictionarycancer https://sj.jst.go.jp/news/202604/n0410-02k.html New treatment strategy for acute myeloid leukemia proposed by Tokai University | News | Science... New treatment strategy for acute myeloid leukemia proposed by Tokai University acute myeloid leukemia https://bkoffman.blogspot.com/2016/07/short-sweet-news-less-cll-chronic.html Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman: Short... https://pure.psu.edu/en/publications/use-of-a-pseudomonas-aeruginosa-vaccine-in-patients-with-acute-le/ Use of a Pseudomonas aeruginosa vaccine in patients with acute leukemia and cystic fibrosis - Penn... https://pubmed.ncbi.nlm.nih.gov/31930552/ A pilot study to establish human T-cell leukemia virus type 1 (HTLV-1) carrier model using common... We obtained HTLV-1 asymptomatic carriers of common marmosets by inoculating MT-2 cells. https://www.cancer.gov/research/participate/clinical-trials-search/v?id=NCI-2024-01721&r=1 Revumenib and Venetoclax for the Treatment of Patients with Acute Myeloid Leukemia with Measurable... Revumenib and Venetoclax for the Treatment of Patients with Acute Myeloid Leukemia with Measurable Residual Disease https://www.bustle.com/articles/114131-ashley-is-bachelor-in-paradise-leukemia-lymphoma-benefit-proves-the-stars-are-still-friends Ashley I.'s 'Bachelor In Paradise' Leukemia & Lymphoma Benefit Proves The Stars Are Still Friends &... Sep 30, 2015 - The show may be over, but the Bachelor in Paradise stars are still great friends. In fact, nine of the contestants will meet up again this weekend for a great... https://www.wikidata.org/wiki/Q78932412 Chromosome studies in human leukemia. 1. Acute leukemia in children - Wikidata scientific article published on 01 November 1961 in humanchromosomestudiesleukemiaacute https://pubmed.ncbi.nlm.nih.gov/36130297/ Genomic profiling for clinical decision making in myeloid neoplasms and acute leukemia Myeloid neoplasms and acute leukemias derive from the clonal expansion of hematopoietic cells driven by somatic gene mutations. Although assessment of... clinical decision makinggenomic profiling https://pmc.ncbi.nlm.nih.gov/articles/PMC4071125/ Risk of leukemia in relation to exposure to ambient air toxics in pregnancy and early childhood -... There are few established causes of leukemia, the most common type of cancer in children. Studies in adults suggest a role for specific environmental agents,... https://www.cancer.columbia.edu/cancer-types-care/types/leukemia/leukemia-types/acute-myeloid-leukemia-aml Acute Myeloid Leukemia (AML) | Herbert Irving Comprehensive Cancer Center (HICCC) - New York Aug 22, 2025 - Learn about the risk factors, symptoms, diagnosis, and treatment of AML. acute myeloid leukemiacomprehensive cancer center https://www.nfl.com/news/auburn-s-shon-coleman-has-beaten-leukemia-in-line-to-start-0ap3000000384101 Auburn's Shon Coleman has beaten leukemia, in line to start Auburn sophomore Shon Coleman will make his first start in five years Saturday. He's replacing stud OT Greg Robinson. But for a guy who has beat leukemia, this... in lineauburnshoncoleman https://bkoffman.blogspot.com/2009/01/forty-thousand-headmen-couldnt-make-me.html Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman: "Forty... https://rarediseases.info.nih.gov/diseases/17450/inherited-acute-myeloid-leukemia Inherited acute myeloid leukemia | About the Disease | GARD Find symptoms and other information about Inherited acute myeloid leukemia. acute myeloid leukemiaabout the diseaseinheritedgard https://medlineplus.gov/leukemia.html Leukemia | MedlinePlus Leukemia is cancer of the white blood cells. There are two types of Leukemias, acute and chronic. Learn about the differences and treatments available. leukemiamedlineplus https://pubmed.ncbi.nlm.nih.gov/38632314/ KRAS G12 mutations as adverse prognostic factors in KMT2A-rearranged acute myeloid leukemia KRAS G12 mutations as adverse prognostic factors in KMT2A-rearranged acute myeloid leukemia https://genomics.ucsf.edu/content/ucsf-juvenile-myelomonocytic-leukemia-associated-exon-panel-jmml UCSF Juvenile Myelomonocytic Leukemia Associated Exon Panel (JMML) | UCSF Health Center for... health centerucsfjuvenileleukemiaassociated https://bkoffman.blogspot.com/2008/10/its-just-way-things-change-now-like.html Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman: "It's... https://veganepicurean.blogspot.com/2010/06/green-tea-extract-helps-to-keep-chronic.html Vegan Epicurean: Green Tea Extract Helps to Keep Chronic Lymphocytic Leukemia (CLL) in Check Years ago I thought food was just something you ate for enjoyment. It took me a long time to realize that food has an enormous impact on he... https://www.sciencedaily.com/releases/2015/04/150429234631.htm Scientists identify key receptors behind development of acute myeloid leukemia | ScienceDaily Scientists have discovered that a certain class of receptors that inhibit immune response are crucial for the development of acute myeloid leukemia (AML), the... acute myeloid leukemiascientistsidentifykeyreceptors https://chibe.upenn.edu/publications/factors-that-contribute-to-disparities-in-time-to-acute-leukemia-diagnosis-in-young-people-an-in-depth-qualitative-interview-study/ Factors That Contribute to Disparities in Time to Acute Leukemia Diagnosis in Young People: An In... https://www.canr.msu.edu/blv/biology/ BLV Biology - Bovine Leukemia Virus blvbiologybovineleukemiavirus https://bkoffman.blogspot.com/2010/09/ct-scans-and-knowing.html Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman: CT scans... https://bkoffman.blogspot.com/2011/12/home-from-ash.html?showComment=1324056655648 Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman: Home... https://bkoffman.blogspot.com/2010/06/profundity-shame-and-denial-of-cancer.html Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman: The... https://www.cirm.ca.gov/about-cirm/publications/notch1-signaling-promotes-human-t-cell-acute-lymphoblastic-leukemia-initiating-cell-regeneration-supportive-niches/ NOTCH1 signaling promotes human T-cell acute lymphoblastic leukemia initiating cell regeneration in... acute lymphoblastic leukemia https://www.techtransfer.nih.gov/patent/e-200-2011-1-us-01 METHODS OF TREATING LYMPHOCYTIC LEUKEMIA USING INHIBITORS OF BRUTON'S TYROSINE KINASE | Technology... https://www.techtransfer.nih.gov/patent/e-660-1984-0-ie-20 PRODUCTION OF HUMAN T-CELL LEUKEMIA (LYMPHOTROPIC) RETROVIRUS (HTLV-I) ENVELOPE PROTEIN FRAGMENTS... https://pubchem.ncbi.nlm.nih.gov/bioassay/43536 AID 43536 - In vitro anticancer activity against CCRF-CEM leukemia cell line; not available -... BioAssay record AID 43536 submitted by ChEMBL: In vitro anticancer activity against CCRF-CEM leukemia cell line; not available. https://www.wikidata.org/wiki/Q37692798 Dasatinib or high-dose imatinib for chronic-phase chronic myeloid leukemia resistant to imatinib at... scientific article published on September 2009 https://pubmed.ncbi.nlm.nih.gov/24954503/ BTK inhibitors in chronic lymphocytic leukemia: a glimpse to the future The treatment of chronic lymphocytic leukemia (CLL) with inhibitors targeting B cell receptor signaling and other survival mechanisms holds great promise.... chronic lymphocytic leukemiabtk inhibitors https://www.news-medical.net/news/20240722/Researchers-discover-new-target-for-treating-diseases-linked-to-T-cell-leukemia-virus-type-1.aspx Researchers discover new target for treating diseases linked to T-cell leukemia virus type 1 Jul 22, 2024 - A team of researchers from Penn State College of Medicine found a new target for treating diseases associated with human T-cell leukemia virus type 1 (HTLV-1). https://bkoffman.blogspot.com/2014/03/the-good-cancer.html Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman: The Good... https://pubmed.ncbi.nlm.nih.gov/40223119/ The RBM39 degrader indisulam inhibits acute megakaryoblastic leukemia by altering the alternative... Indisulam is a promising therapeutic candidate for AMKL and the RBM39-mediated ZMYND8 splicing plays an important role in promoting the development of AMKL. degrader https://pubchem.ncbi.nlm.nih.gov/bioassay/1342202 AID 1342202 - Toxicity in patient with chronic lymphocytic leukemia and lymphoma assessed as... BioAssay record AID 1342202 submitted by ChEMBL: Toxicity in patient with chronic lymphocytic leukemia and lymphoma assessed as incidence of grade more than... chronic lymphocytic leukemia https://www.cbsnews.com/news/sam-cunningham-bruce-pearl-friendship-auburn-basketball-leukemia-cancer/ How a student's friendship with Auburn coach Bruce Pearl gave him the strength to beat leukemia -... Sam Cunningham was diagnosed with leukemia at the age of 12. Seven years later, he's the Auburn men's basketball team manager. https://cordis.europa.eu/project/id/894106/reporting/de Molecular, Structural, and Functional Studies of Leukemia-Associated Transcription... Latest report summary functional studiesmolecularstructuralleukemiaassociated https://www.sciencenews.org/archive/human-leukemia-virus Human Leukemia Virus | Science News humanleukemiavirussciencenews https://io.wiktionary.org/wiki/leukemia leukemia - Wikivortaro leukemia https://bkoffman.blogspot.com/2018/03/get-my-car-t-cells-tomorrow-for-mycll.html?showComment=1522970985257 Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman: GET MY... https://magazine.wharton.upenn.edu/tag/chronic-myelogenous-leukemia/ chronic myelogenous leukemia Archives - Wharton Magazine chronic myelogenous leukemiaarchiveswhartonmagazine https://pubmed.ncbi.nlm.nih.gov/12685468/ A case-control study of childhood leukemia in Woburn, Massachusetts: the relationship between... A 1981 Massachusetts Department of Public Health study confirmed a childhood leukemia cluster in Woburn, Massachusetts. Our follow-up investigation attempts to... https://cancercenter.arizona.edu/events/27770-leukemia-and-lymphoma-society-family-support-group-virtual Leukemia and Lymphoma Society Family Support Group - Virtual | Cancer Center leukemia and lymphomafamily support groupsocietyvirtualcancer https://pubmed.ncbi.nlm.nih.gov/34244384/ Mapping the cellular origin and early evolution of leukemia in Down syndrome Children with Down syndrome have a 150-fold increased risk of developing myeloid leukemia, but the mechanism of predisposition is unclear. Because Down... early evolution https://ms.wikipedia.org/wiki/Kategori:Kematian_akibat_Leukemia Kategori:Kematian akibat Leukemia - Wikipedia Bahasa Melayu, ensiklopedia bebas bahasa melayukategorikematianakibatleukemia https://www.redcross.org/local/me-nh-vt/about-us/news-and-events/news/battling-leukemia.html Battling Leukemia | Article | Red Cross of Northern New England red crossbattlingleukemiaarticlenorthern https://bkoffman.blogspot.com/2019/05/acalabrutinib-phase-iii-ascend-trial.html Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman:... https://bkoffman.blogspot.com/2009/05/whats-new.html?showComment=1242750360000 Learning from and about cancer (chronic lymphocytic leukemia or CLL) by Dr. Brian Koffman: What's... https://pubmed.ncbi.nlm.nih.gov/39561285/ Bivalent CD47 immunotoxin for targeted therapy of T-cell acute lymphoblastic leukemia CD47 is overexpressed on the surface of many types of cancer cells, including T-cell acute lymphoblastic leukemia (T-ALL) cells. In this study, we have... targeted therapy https://tacl.chla.usc.edu/tacl/SimplePage/Page/268 TACL - Therapeutic Advances In Childhood Leukemia & Lymphoma The TACL consortium's mission is to develop innovative therapies for currently incurable leukemia and lymphoma. childhood leukemiatacltherapeuticadvanceslymphoma https://data.mendeley.com/datasets/fhjtp3xp56/1 Raw data blocco 4-Prognostic significance of PET/CT in patients with chronic lymphocytic leukemia... research data of the work-4 https://rarediseases.info.nih.gov/diseases/24298/blast-phase-chronic-myelogenous-leukemia-bcr-abl1-positive Blast phase chronic myelogenous leukemia, BCR-ABL1 positive | About the Disease | GARD Find symptoms and other information about Blast phase chronic myelogenous leukemia, BCR-ABL1 positive. chronic myelogenous leukemiaabout the disease https://news.feinberg.northwestern.edu/2017/02/24/evaluating-a-novel-chemo-free-combination-therapy-for-lymphocytic-leukemia/ Evaluating A Novel Chemo-free Combination Therapy for Lymphocytic Leukemia - News Center Feb 24, 2017 - A phase 1 clinical trial of venetoclax and rituximab combination therapy was shown to be an effective chemo-free treatment option for patients with... a novelcombination therapy https://pubmed.ncbi.nlm.nih.gov/11704842/ All trans retinoic acid in acute promyelocytic leukemia All trans retinoic acid (ATRA) is able to induce complete remission (CR) in almost all patients with acute promyelocytic leukemia (APL) through in vivo... all transretinoic acidacuteleukemia https://adisinsight.springer.com/drugs/800028414?error=cookies_not_supported&code=76fbcf26-dca8-480d-b02b-4dd869aa3cdd Research programme: acute myelogenous leukaemia therapy - Provid Pharmaceuticals/The Leukemia &... research programmeacuteleukaemiatherapypharmaceuticals