Robuta

https://www.frontiersin.org/journals/neurology/articles/10.3389/fneur.2024.1383227/full Frontiers | Circulating plasma-derived extracellular vesicles expressing bone and kidney markers... Background: Although effective antiretroviral therapy (ART) has improved the life expectancy of people with HIV (PWH), the prevalence of milder forms of HIV-... extracellular vesiclesfrontierscirculatingplasmaderived https://elifesciences.org/articles/57668 Extracellular Matrix: Sculpting new structures | eLife The origins of the posterior lobe, a recently evolved structure in some species of Drosophila, have become clearer. extracellular matrixnew structuressculptingelife https://www.semanticscholar.org/topic/extracellular-matrix-structural-constituent/1623045 extracellular matrix structural constituent | Semantic Scholar The action of a molecule that contributes to the structural integrity of the extracellular matrix. [GOC:mah] extracellular matrixstructuralconstituentsemanticscholar https://pmc.ncbi.nlm.nih.gov/articles/PMC11549053/ Variable bioenergetic sensitivity of neurons and astrocytes to insulin and extracellular glucose -... Energy flow within cellular elements of the brain is a well-orchestrated, tightly regulated process, however, details underlying these functions at the... variablebioenergeticsensitivityneurons https://www.preprints.org/manuscript/202103.0696 Characterization of Extracellular Vesicles Secreted in Lentiviral Producing HEK293SF Cell... Lentiviral vectors (LVs) are a powerful tool for gene and cell therapy and human embryonic kidney cells (HEK293) have been extensively used as a platform for... extracellular vesiclescharacterizationsecretedlentiviralproducing https://www.siemens-healthineers.com/fr-be/computed-tomography/naeotom/pcct-scientific-evidence/mergen-jun-2022 Extracellular volume quantification with cardiac late enhancement scanning using dual-source... This study evaluated the feasibility and accuracy of cardiac late enhancement (LE) scanning for extracellular volume (ECV) quantification with NAEOTOM Alpha. extracellular volumequantificationcardiac https://pmc.ncbi.nlm.nih.gov/articles/PMC8452311/ Non-linear dimensionality reduction on extracellular waveforms reveals cell type diversity in... Cortical circuits are thought to contain a large number of cell types that coordinate to produce behavior. Current in vivo methods rely on clustering of... non lineardimensionality reduction https://www.frontiersin.org/research-topics/57737/extracellular-vesicles-emerging-roles-in-the-aged-and-neurodegenerative-brain/magazine Extracellular vesicles: emerging roles in the aged and neurodegenerative brain | Frontiers Research... Research into extracellular vesicles (EVs) biology has increased considerably over the past decade, posing manifold questions regarding their involvement in... extracellular vesiclesemerging roles https://www.uu.se/en/department/medical-biochemistry-and-microbiology/news/archive/2024-01-30-imbim-collaboration-explains-how-mast-cells-can-differentiate-between-invasive-and-extracellular-bacteria IMBIM collaboration explains how mast cells can differentiate between invasive and extracellular... mast cells https://elifesciences.org/articles/34961/figures Figures and data in Variations in HLA-B cell surface expression, half-life and extracellular... Lymphocytes and monocytes maintain their cell surface HLA-B via different mechanisms, which in turn differently influence cell-surface expression, half-life... figures and data https://www.universiteitleiden.nl/onderzoek/onderzoeksoutput/wiskunde-en-natuurwetenschappen/amoeboid-cell-migration-and-physicochemical-properties-of-the-extracellular-environment Amoeboid cell migration and physicochemical properties of the extracellular environment -... This dissertation aims to advance understanding of amoeboid single cell migration under the influence of changing physicochemical environmental properties. The... amoeboid cellphysicochemical propertiesof themigrationextracellular https://www.siemens-healthineers.com/en-ph/computed-tomography/naeotom/pcct-scientific-evidence/mergen-jun-2024 Synthetic hematocrit from virtual non-contrast images for myocardial extracellular volume... Synthetic hematocrit from virtual non-contrast images for myocardial extracellular volume evaluation with photon-counting detector CT from virtualimages forsynthetichematocritnon https://www.kth.se/en/om/upptack/kalender/disputationer/development-of-techniques-for-characterization-detection-and-protein-profiling-of-extracellular-vesicles-1.1119461 Development of Techniques for Characterization, Detection and Protein Profiling of Extracellular... protein profilingdevelopmenttechniquescharacterizationdetection https://www.doccheck.com/en/detail/photos/17189-cil-7867 Mus musculus (Extracellular matrix part) - CIL:7867 - DocCheck This is part of a triplicate data set of non-overlapping fields of NIH 3T3 fibroblasts cultured on polystyrene. Each set is indicated by the well number. Each... mus musculusextracellular matrixpartcildoccheck https://www.timeshighereducation.com/news/symposium-bursaries-the-biology-of-extracellular-molecular-chaperones/206091.article Symposium Bursaries - The biology of extracellular molecular chaperones | Times Higher Education... May 22, 2015 - Deadline: 01/03/2007 molecular chaperonestimes highersymposiumbursariesbiology https://www.donau-uni.ac.at/en/university/faculties/health-medicine/departments/biomedical-research/centers/biomedical-technology/research/extracellular-vesicles.html Additional Module of the CD-Lab- Extracellular Vesicles - University for Continuing Education Krems The main goal of the additional modul of the Christian Doppler Laboratory for Innovative Therapy Approaches in Sepsis is the establishment of new met https://pmc.ncbi.nlm.nih.gov/articles/PMC8869966/ Cannabinoids Reduce Extracellular Vesicle Release from HIV-1 Infected Myeloid Cells and Inhibit... Of the 37.9 million individuals infected with human immunodeficiency virus type 1 (HIV-1), approximately 50% exhibit HIV-associated neurocognitive disorders... https://www.wikidata.org/wiki/Q72288127 Intercellular calcium signaling induced by extracellular adenosine 5'-triphosphate and mechanical... scientific article published on 01 December 1993 adenosine 5 triphosphatecalcium signalingintercellularinduced https://www.doccheck.com/de/detail/photos/17205-cil-7885 Mus musculus (Extracellular matrix part) - CIL:7885 - DocCheck This is part of a triplicate data set of non-overlapping fields of NIH 3T3 fibroblasts cultured on polystyrene. Each set is indicated by the well number. Each... mus musculusextracellular matrixpartcildoccheck https://www.vumc.org/patel-lab/publication/cocaine-induced-endocannabinoid-signaling-mediated-sigma-1-receptors-and-extracellular Cocaine-induced endocannabinoid signaling mediated by sigma-1 receptors and extracellular vesicle... https://www.rcsb.org/structure/6PYH RCSB PDB - 6PYH: Cryo-EM structure of full-length IGF1R-IGF1 complex. Only the extracellular region... Cryo-EM structure of full-length IGF1R-IGF1 complex. Only the extracellular region of the complex is resolved. https://www.mdpi.com/1422-0067/24/13/11151 Therapeutic Potential of Mesenchymal Stem Cell-Derived Extracellular Vesicles to Treat PCOS Polycystic ovary syndrome (PCOS) is known as the most common endocrine disorder in women. Previously, we suggested that human mesenchymal stem cells (MSCs) can... mesenchymal stem celltherapeutic potential https://www.frontiersin.org/journals/microbiology/articles/10.3389/fmicb.2022.971433/full Frontiers | Effects of extracellular polymeric substances on the aggregation of Aphanizomenon... Aphanizomenon flos-aquae (A. flos-aquae) blooms are serious environmental and ecological problems. Extracellular polymeric substances (EPSs) are among the mo... on thefrontierseffectsextracellularpolymeric https://www.biocolor.co.uk/ Biocolor Extracellular Matrix assay kits extracellular matrixbiocolorassaykits https://www.doccheck.com/en/detail/photos/17389-cil-9005 Mus musculus (Extracellular matrix part) - CIL:9005 - DocCheck This is part of a triplicate data set of non-overlapping fields of NIH 3T3 fibroblasts cultured on polystyrene. Each set is indicated by the well number. Each... mus musculusextracellular matrixpartcildoccheck https://pmc.ncbi.nlm.nih.gov/articles/PMC11106384/ Immunomodulatory properties of Bacillus subtilis extracellular vesicles on rainbow trout intestinal... Extracellular vesicles (EVs) are cell-derived membrane-surrounded vesicles that carry bioactive molecules. Among EVs, outer membrane vesicles (OMVs),... bacillus subtilisextracellular vesiclesrainbow troutimmunomodulatoryproperties https://jewishpress.com/tag/extracellular-bubbles/ extracellular bubbles Archives - The Jewish Press - JewishPress.com the jewish pressextracellularbubblesarchivesjewishpress https://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2021.645304/full Frontiers | Bovine Neutrophils Release Extracellular Traps and Cooperate With Macrophages in... Mycobacterium avium subsp. paratuberculosis (Map) is the underlying pathogen causing bovine paratuberculosis (PTB), an enteric granulomatous disease that mai... cooperate withfrontiersbovineneutrophilsrelease https://www.frontiersin.org/journals/cellular-neuroscience/articles/10.3389/fncel.2013.00023/full Frontiers | Different transporter systems regulate extracellular GABA from vesicular and... Tonic GABAA conductance is a key factor regulating neuronal excitability and computation in neuronal networks. The magnitude of the tonic GABAA conductance d... frontiersdifferenttransportersystemsregulate https://www.frontiersin.org/research-topics/69287/exploring-extracellular-vesicles-in-intervertebral-disc-degenerative-mechanisms-and-regenerative-application/impact Frontiers | Exploring Extracellular Vesicles in Intervertebral Disc: Degenerative Mechanisms and... Extracellular vesicles (EVs) have constituted a prominent area of research in recent years. As a mediator of intercellular communication, EVs play an undenia... extracellular vesiclesintervertebral discfrontiersexploringdegenerative https://pmc.ncbi.nlm.nih.gov/articles/PMC4082760/ Extracellular vesicles: Emerging targets for cancer therapy - PMC Extracellular vesicles (EVs), including exosomes, microvesicles and apoptotic bodies, are released by almost all cell types, including tumour cells. Through... extracellular vesiclescancer therapyemergingtargetspmc https://www.sympla.com.br/evento-online/international-symposium-extracellular-vesicles-in-cancer-biology/3084321?lang=en International Symposium: Extracellular Vesicles in Cancer Biology - online - Sympla International Symposium: Extracellular Vesicles in Cancer Biology - online. Confira eventos e cursos online na Sympla! international symposiumextracellular vesiclescancer biologyonlinesympla https://elifesciences.org/reviewed-preprints/96076v2/reviews Gliogenesis from the subventricular zone modulates the extracellular matrix at the glial scar after... from thesubventricular zone https://www.frontiersin.org/journals/endocrinology/articles/10.3389/fendo.2021.758206/full Frontiers | The Emerging Roles and Therapeutic Potential of Extracellular Vesicles in Infertility Infertility is becoming much more common and affects more couples. The past years witnessed the rapid development of the diagnosis and treatment upon inferti... emerging rolestherapeutic potential https://www.news-medical.net/news/20210918/Higher-white-matter-extracellular-free-water-related-to-cognitive-dysfunction-in-lupus-patients.aspx Higher white matter extracellular free-water related to cognitive dysfunction in lupus patients Sep 18, 2021 - Systemic lupus erythematosus (SLE) is an autoimmune disease in which the immune system attacks the body's own tissues, causing widespread inflammation and... https://www.corning.com/emea/de/products/life-sciences/resources/stories/at-the-bench/extracellular-vesicle-production-characterization-and-quantification-methods.html Extracellular Vesicles: EV Production, Characterization, And Quantification Methods | Corning Extracellular vesicles represent significant opportunity for the biologics space. Learn about their biology, therapeutic application, and ultimate value. extracellular vesiclesevproductioncharacterizationquantification https://www.jci.org/articles/view/206849 JCI - Corrigendum to Myeloperoxidase-anchored ENO1 mediates neutrophil extracellular trap DNA to... neutrophil extracellular trapjcicorrigendummyeloperoxidaseanchored https://pmc.ncbi.nlm.nih.gov/articles/PMC12221982/ The structure of the complete extracellular bacterial flagellum reveals the mechanism of flagellin... The bacterial flagellum is essential for motility, adhesion and colonization in pathogens such as Salmonella enterica and Campylobacter jejuni. Its... the structurebacterial flagellumcompleteextracellularreveals https://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2023.1209898/full Frontiers | Goat milk extracellular vesicles: immuno-modulation effects on porcine monocyte-derived... Extracellular vesicles (EVs) are nanometric-membrane-bound sub-cellular structures, which can be recovered from milk. Milk EVs have drawn increasing interest... goat milkextracellular vesicles https://www.wikidata.org/wiki/Q77164560 Substitution of extracellular sodium chloride with sodium sulfate or saccharose and its effect on... scientific article published on 01 January 1957 https://elifesciences.org/articles/96941 Compositional editing of extracellular matrices by CRISPR/Cas9 engineering of human mesenchymal... Human extracellular matrices can be edited in their composition using the CRISPR/Cas9 system, leading to materials exhibiting tailored regenerative capacities. extracellular matricescrispr cas9compositionalediting https://www.mdpi.com/1422-0067/24/6/5969 Elevations of Extracellular Vesicles and Inflammatory Biomarkers in Closed Circuit SCUBA Divers Blood-borne extracellular vesicles and inflammatory mediators were evaluated in divers using a closed circuit rebreathing apparatus and custom-mixed gases to... closed circuit scubaextracellular vesicles https://www.wikidata.org/wiki/Q36254982 SWI/SNF: the crossroads where extracellular signaling pathways meet chromatin. - Wikidata swi snfthe crossroadssignaling pathways https://www.norev.org/ Norwegian Society for Extracellular Vesicles norwegian societyextracellularvesicles https://www.frontiersin.org/journals/plant-science/articles/10.3389/fpls.2021.788514/full Frontiers | Damage Signaling by Extracellular Nucleotides: A Role for Cyclic Nucleotides in... Extracellular ATP (eATP) is now held to be a constitutive Damage Associated Molecular Pattern (DAMP) that is released by wounding, herbivory or pathogen atta... frontiersdamagesignalingextracellular https://www.mdpi.com/1422-0067/23/24/16095 Prolonged Exposure to Simulated Microgravity Changes Release of Small Extracellular Vesicle in... Breast cancer is the leading cause of cancer incidence worldwide and among the five leading causes of cancer mortality. Despite major improvements in early... small extracellular vesicleprolonged exposure https://www.spandidos-publications.com/10.3892/mmr.2011.459 Single-prolonged stress induces increased phosphorylation of extracellular signal-regulated kinase... Covers molecular medicine topics such as pharmacology, pathology, genetics, neuroscience, infectious diseases, molecular cardiology, and molecular surgery. singleprolongedstressinducesincreased https://3dprint.com/tag/extracellular-matrices/ Extracellular Matrices Archives - 3DPrint.com | Additive Manufacturing Business extracellular matricesadditive manufacturingarchivesbusiness https://www.jci.org/articles/view/170246/ga JCI - ADAMTS12 promotes fibrosis by restructuring extracellular matrix to enable activation of... https://www.corning.com/emea/de/products/life-sciences/products/surfaces/ECMs-and-biologically-coated-surfaces.html ECMs and Biologically Coated Surfaces | Extracellular Matrices | Corning extracellular matricesecmsbiologicallycoatedsurfaces https://www.frontiersin.org/journals/cell-and-developmental-biology/articles/10.3389/fcell.2024.1279932/full Frontiers | Characterization of cardiac fibroblast-extracellular matrix crosstalk across... Heart failure afflicts an estimated 6.5 million people in the United States, driven largely by incidents of coronary heart disease (CHD). CHD leads to heart ... extracellular matrixfrontierscharacterizationcardiacfibroblast https://elifesciences.org/articles/55965 Evolutionary expansion of apical extracellular matrix is required for the elongation of cells in a... A new morphological structure evolved through extreme changes in cell height requires novel connections to an extracellular matrix network, which predates the... https://www.news-medical.net/life-sciences/Detecting-Extracellular-Vesicles-in-Urine-Using-a-Robust-Assay.aspx Detecting Extracellular Vesicles in Urine Using a Robust Assay Jul 31, 2019 - This article describes how extracellular vesicles are detected and the development of a robust and reproducible assay that overcomes previous limitations. extracellular vesiclesdetectingurineusingrobust https://elifesciences.org/articles/38060v1/peer-reviews Peer review in BK channel inhibition by strong extracellular acidification | eLife peer reviewbk channel https://www.frontiersin.org/research-topics/17184/extracellular-vesicles-as-next-generation-therapeutics/magazine Extracellular Vesicles as Next Generation Therapeutics | Frontiers Research Topic Extracellular vesicles (EVs) are small, circular structures derived from any type of cells, which play an important role in cell-to-cell communication. They... extracellular vesiclesnext generationtherapeuticsfrontiersresearch https://www.sfn.org/Publications/Latest-News/2018/11/05/Extracellular-Vesicles-Help-Pass-Information-Between-Cells-and-onto-Offspring Society for Neuroscience - Extracellular Vesicles Help Pass Information Between Cells and onto... society for neuroscienceextracellular vesicles https://www.helsinki.fi/en/researchgroups/extracellular-vesicles/publications Publications | Extracellular Vesicles | University of Helsinki Recent publications of the Extracellular Vesicles research group extracellular vesiclesuniversity ofpublicationshelsinki https://www.corning.com/emea/en/products/life-sciences/resources/webforms/whitepaper-guide-to-extracellular-vesicles.html Whitepaper: Guide to Extracellular Vesicles With more efficient and consistent production methods, researchers will be able to harness the enormous potential of EVs for clinical diagnostics, prognostics,... guide towhitepaperextracellularvesicles https://www.sciencedaily.com/releases/2018/03/180312161347.htm Extracellular vesicles could be personalized drug delivery vehicles | ScienceDaily Creating enough nanovesicles to inexpensively serve as a drug delivery system may be as simple as putting the cells through a sieve, according to an... extracellular vesiclescould bedrug deliverypersonalizedvehicles https://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2025.1480292/full Frontiers | The extracellular vesicle-based treatment: a developing strategy for periodontal... Periodontitis, a chronic inflammatory disease, is characterized by irreversible bone resorption, persistent attachment loss, and even ultimate tooth loss. Th... extracellular vesiclefrontiersbased https://elifesciences.org/articles/87501v1 Plasma extracellular vesicle synaptic proteins as biomarkers of clinical progression in patients... The promising potential of plasma extracellular vesicle synaptic proteins as clinical biomarkers of disease progression in Parkinson's disease has been... extracellular vesicle https://www.frontiersin.org/journals/genetics/articles/10.3389/fgene.2021.778416/full Frontiers | Open Problems in Extracellular RNA Data Analysis: Insights From an ERCC Online Workshop We now know RNA can survive the harsh environment of biofluids when encapsulated in vesicles or by associating with lipoproteins or RNA binding proteins. The... https://www.precedenceresearch.com/extracellular-vesicles-based-liquid-biopsy-market Extracellular Vesicles-Based Liquid Biopsy Market Size to Hit USD 149.66 Million by 2034 The global extracellular vesicles-based liquid biopsy market size is evaluated at USD 122.72 million in 2025 and is predicted to hit around USD 149.66 million... https://pmc.ncbi.nlm.nih.gov/articles/PMC10957175/ Assembly of neuron- and radial glial-cell-derived extracellular matrix molecules promotes radial... Radial neuronal migration is a key neurodevelopmental event for proper cortical laminar organization. The multipolar-to-bipolar transition, a critical step in... radial glial cell https://elifesciences.org/articles/49175/peer-reviews Peer review in Extracellular Pgk1 enhances neurite outgrowth of motoneurons through... The amount of secreted Pgk1 is sharply decreased in Rtn4al/NogoA-overexpressed muscle cells, leading to various manifestations of neurodegenerative disease,... peer reviewneurite outgrowthextracellularpgk1 https://www.ncbi.nlm.nih.gov/Structure/pdb/1OSX 1OSX: Solution Structure of the Extracellular Domain of BLyS Receptor 3 (BR3) Tumor necrosis factor receptor superfamily member 13C of theextracellular domainsolutionstructure https://www.siemens-healthineers.com/vn/computed-tomography/naeotom/pcct-scientific-evidence/mergen-jun-2024 Synthetic hematocrit from virtual non-contrast images for myocardial extracellular volume... Synthetic hematocrit from virtual non-contrast images for myocardial extracellular volume evaluation with photon-counting detector CT from virtualimages forsynthetichematocritnon https://www.jci.org/assets/270893/powerpoint JCI - Extracellular matrix proteases contribute to progression of pelvic organ prolapse in mice and... https://pmc.ncbi.nlm.nih.gov/articles/PMC8928950/ The Effect of Lactobacillus plantarum Extracellular Vesicles from Korean Women in Their 20s on Skin... Extracellular vesicles, which are highly conserved in most cells, contain biologically active substances. The vesicles and substances interact with cells and... https://www.siemens-healthineers.com/tr/computed-tomography/naeotom/pcct-scientific-evidence/mergen-jun-2022 Extracellular volume quantification with cardiac late enhancement scanning using dual-source... This study evaluated the feasibility and accuracy of cardiac late enhancement (LE) scanning for extracellular volume (ECV) quantification with NAEOTOM Alpha. extracellular volumequantificationcardiac https://www.wikidata.org/wiki/Q40579098 Transcriptional regulation by extracellular signals: mechanisms and specificity - Wikidata scientific article published on January 1995 transcriptional regulationextracellular signalsmechanismsspecificitywikidata https://www.frontiersin.org/journals/microbiology/articles/10.3389/fmicb.2016.01134/full Frontiers | Probing Synechocystis-Arsenic Interactions through Extracellular Nanowires Microbial nanowires (MNWs) can play an important role in the transformation and mobility of toxic metals/metalloids in environment. The potential role of MNW... frontiersprobingsynechocystisarsenicinteractions https://www.spandidos-publications.com/10.3892/ijmm.2017.2962 The extracellular signal-regulated kinase 1/2 pathway in neurological diseases: A potential... International Journal of Molecular Medicine is an international journal devoted to molecular mechanisms of human disease. https://www.siemens-healthineers.com/en-iq/computed-tomography/naeotom/pcct-scientific-evidence/mergen-jun-2024 Synthetic hematocrit from virtual non-contrast images for myocardial extracellular volume... Synthetic hematocrit from virtual non-contrast images for myocardial extracellular volume evaluation with photon-counting detector CT from virtualimages forsynthetichematocritnon https://www.jci.org/articles/view/138986 JCI - ANGPTL2-containing small extracellular vesicles from vascular endothelial cells accelerate... vascular endothelial cellsextracellular vesiclesjciangptl2containing https://www.frontiersin.org/journals/cellular-and-infection-microbiology/articles/10.3389/fcimb.2020.00099/full Frontiers | Trypanosoma cruzi-Infected Human Macrophages Shed Proinflammatory Extracellular... Extracellular vesicles (EVs) shed by trypomastigote forms of Trypanosoma cruzi have the ability to interact with host tissues, increase invasion, and modulat... trypanosoma cruzifrontiersinfectedhumanmacrophages https://elifesciences.org/articles/88675 Circulating small extracellular vesicle RNA profiling for the detection of T1a stage colorectal... Whole-transcriptomic profiling of circulating small extracellular vesicle RNA facilitates the detection of T1a stage colorectal cancer and precancerous... small extracellular vesicle https://www.sify.com/tag/extracellular-electron-transfer/ extracellular electron transfer Archives - Sify electron transferextracellulararchivessify https://pmc.ncbi.nlm.nih.gov/articles/PMC12875102/ The peritoneum in perspective: extracellular vesicles and the future of peritoneal dialysis - PMC Peritoneal dialysis (PD) transforms the peritoneum into a dynamic therapeutic interface, with each exchange offering direct access to molecular and cellular... the peritoneumin perspectiveextracellular vesicles https://www.jci.org/assets/400140/powerpoint JCI - Erythrocyte-derived extracellular vesicles induce endothelial dysfunction through arginase-1... extracellular vesiclesendothelial dysfunctionjcierythrocytederived https://elifesciences.org/articles/25474v1 A lectin receptor kinase as a potential sensor for extracellular nicotinamide adenine dinucleotide... https://www.corning.com/in/en/products/life-sciences/resources/webforms/whitepaper-guide-to-extracellular-vesicles.html Whitepaper: Guide to Extracellular Vesicles With more efficient and consistent production methods, researchers will be able to harness the enormous potential of EVs for clinical diagnostics, prognostics,... guide towhitepaperextracellularvesicles https://www.jci.org/articles/view/4327/pdf JCI - Compartmentalization of extracellular cGMP determines absorptive or secretory responses in... jcicompartmentalizationextracellularcgmp https://www.corning.com/kr/ko/products/life-sciences/applications/bioprocess-applications/extracellular-vesicles.html Extracellular Vesicles Therapy Research Products | Corning Extracellular Vesicles hold great therapeutic promise. Corning allows for optimized EV production with our large-scale cell culture application products. extracellular vesiclesresearch productstherapycorning https://www.mdpi.com/1422-0067/24/4/3500 Extracellular Vesicles Released from Cancer Cells Promote Tumorigenesis by Inducing Epithelial to... Lung cancer is the leading cause of cancer-related deaths globally, in part due to a lack of early diagnostic tools and effective pharmacological... extracellular vesiclescancer cells https://www.longdom.org/proceedings/relugolix--elagolix-inhibit-leiomyoma-extracellular-matrix-production-61698.html Relugolix and elagolix inhibit leiomyoma extracellular matrix pro | 61698 Longdom Publishing SL is one of the leading international open access journals publishers, covering clinical, medical, and technology-oriented subjects extracellular matrixrelugolixelagolixinhibitleiomyoma https://www.donau-uni.ac.at/de/universitaet/fakultaeten/gesundheit-medizin/departments/biomedizinische-forschung/zentren/biomedizinische-technologie/forschung/crosstalk-circulating-evs-and-vascular-immune-cells/role-of-extracellular-vesicles-carrying-.html Role of Extracellular Vesicles Carrying Oxidation-Specific Epitopes in the Induction of... extracellular vesiclesin therolecarrying https://www.metves.eu/ Standardisation of concentration measurements of extracellular vesicles for medical diagnoses -... METVESII: standardisation of concentration measurements of extracellular vesicles for medical diagnoses concentration measurementsextracellular vesiclesfor medicalstandardisationdiagnoses https://www.mdpi.com/2077-0383/10/21/4860 Exploratory Profiling of Extracellular MicroRNAs in Cerebrospinal Fluid Comparing Leptomeningeal... The diagnosis of leptomeningeal metastasis (LM) is often difficult due to the paucity of cancer cells in cerebrospinal fluid (CSF) and nonspecific findings on... cerebrospinal fluidexploratoryprofilingextracellularmicrornas https://www.wikidata.org/wiki/Q33768716 The influence of extracellular thyroxine-binding protein upon the accumulation of thyroxine by... thyroxine binding proteinthe influenceextracellularuponaccumulation https://www.jci.org/articles/view/67484/pdf JCI - Neutrophil extracellular traps sequester circulating tumor cells and promote metastasis circulating tumor cellsjcineutrophilextracellulartraps https://www.muni.cz/en/research/publications/2470180 The Role of Phosphatidylserine-positive Extracellular Vesicles in Intercellular Communication |... the role ofextracellular vesiclesphosphatidylserinepositiveintercellular https://www.mdpi.com/2077-0375/12/3/324 The Role of Extracellular Vesicles in Osteoporosis: A Scoping Review As an insidious metabolic bone disease, osteoporosis plagues the world, with high incidence rates. Patients with osteoporosis are prone to falls and becoming... the role ofextracellular vesiclesosteoporosisscopingreview https://www.wikidata.org/wiki/Q51787878 Extracellular dopamine in rat striatum following uptake inhibition by cocaine, nomifensine and... scientific article published in July 1987 https://www.ojp.gov/ncjrs/virtual-library/abstracts/calculation-weight-evidence-combined-single-cell-and-extracellular Calculation of the Weight of Evidence for Combined Single-Cell and Extracellular Forensic DNA This article presents a workflow for calculating the likelihood ratio, for the analysis of DNA evidence for forensic applications, that combines single-cell... https://www.elsevier.es/es-revista-clinica-e-investigacion-arteriosclerosis-15-estadisticas-novel-protocol-for-transcriptomic-analysis-S0214916824000792 Novel protocol for the transcriptomic analysis of endothelial extracellular vesicles in... for theextracellular vesiclesnovelprotocoltranscriptomic https://pmc.ncbi.nlm.nih.gov/articles/PMC44920/ Iron acquisition from heme and hemoglobin by a Serratia marcescens extracellular protein - PMC Several pathogenic bacteria are able to use heme and hemoproteins as iron sources independent of siderophore production by mechanisms involving outer membrane... https://www.rcsb.org/structure/3P11 RCSB PDB - 3P11: anti-EGFR/HER3 Fab DL11 in complex with domains I-III of the HER3 extracellular... anti-EGFR/HER3 Fab DL11 in complex with domains I-III of the HER3 extracellular region https://www.frontiersin.org/journals/neuroscience/articles/10.3389/fnins.2017.00667/full Frontiers | Extracellular Tau and Its Potential Role in the Propagation of Tau Pathology The pathological aggregation of tau protein is a hallmark of a set of neurodegenerative diseases collectively referred to as tauopathies. Tau aggregates inde... tau and https://www.muni.cz/en/research/publications/2419626 Fibrotic extracellular matrix impacts cardiomyocyte phenotype and function in an iPSC-derived... extracellular matrix