Robuta

Sponsored by eBay lipase | Shop on eBay Buy and sell on the world's online marketplace. Top brands, low prices, and free shipping on many items. https://portuguese.habioenzyme.com/ Qualidade Enzima do Phytase & Enzima do Lipase fábrica da China Principal fornecedor da China de Enzima do Phytase e Enzima do Lipase, Mianyang Habio Bioengineering Co., Ltd. é Enzima do Lipase fábrica. enzima do phytasequalidadelipasechina https://ri.diva-portal.org/smash/record.jsf?faces-redirect=true&language=no&searchType=SIMPLE&query=&af=%5B%5D&aq=%5B%5B%5D%5D&aq2=%5B%5B%5D%5D&aqe=%5B%5D&pid=diva2%3A1054267&noOfRows=50&sortOrder=author_sort_asc&sortOrder2=title_sort_asc&onlyFullText=false&sf=all Interaction of Rhizomucor miehei lipase with an amphoteria surfactant at different pH values https://www.healthcare.uiowa.edu/path_handbook/rhandbook/test1239.html Lipase lipase https://nhhealthcost.nh.gov/costs/medical/result/lipase-fat-enzyme-level?carrier=uninsured&%3Bamp%3Bcost_type=&%3Bcost_type=&cost_type=medical Lipase (Fat Enzyme) Level Costs | NH Health Cost lipasefatenzymelevelcosts https://www.repository.cam.ac.uk/items/7fac9f6c-dd8b-4a87-9082-3637eda9ed98 Retrospective analysis of association between hepatopathy and serum DGGR lipase activity in dogs: a... 1,2-o-dilauryl-rac-glycero-3-glutaric acid-(6'-methylresorufin) ester (DGGR) lipase assays are used to measure lipase activity in the diagnosis of... https://archives.collections.ed.ac.uk/repositories/2/archival_objects/51889 A comparison of some characteristics of lipoprotein lipase activity from adipose and heart tissues... https://research.monash.edu/en/publications/an-overview-on-immobilization-techniques-of-lipase/ An overview on immobilization techniques of lipase - Monash University an overviewimmobilizationtechniqueslipasemonash https://research.wur.nl/en/publications/temperature-effects-on-lipase-catalyzed-esterification-on-micro-a/ Temperature Effects on Lipase-Catalyzed Esterification on Micro and Bench Scale - Wageningen... bench scaletemperatureeffectslipase https://www.nist.gov/publications/thermodynamics-lipase-catalyzed-esterification-1-dodecanoic-acid-and-1-dodecanol-0 Thermodynamics of the Lipase Catalyzed Esterification of 1-Dodecanoic acid and 1-Dodecanol in... of the https://portal.fis.tum.de/en/publications/a-one-pot-reaction-cascade-of-in-situ-hydrogen-peroxide-productio/ A one pot reaction cascade of in situ hydrogen peroxide production and lipase mediated in situ... https://publica.fraunhofer.de/entities/publication/56dc07ab-0c08-4a27-b4f2-d2ca3dcbceec Lipase-mediated epoxidation of the cyclic monoterpene limonene to limonene oxide and limonene... Limonene is an industrially interesting monoterpene that accumulates in bulk quantities as by-product of the fruit juice industry. The corresponding epoxides... of thelipasemediated https://pure.psu.edu/en/publications/epigallocatechin-3-gallate-inhibits-pancreatic-lipase-and-reduces/ (-)-epigallocatechin-3-gallate inhibits pancreatic lipase and reduces body weight gain in high... https://www.ncbi.nlm.nih.gov/Structure/pdb/6KHK 6KHK: Lipase (Closed form) Hydrolase, alpha/beta domain proteinGLYCEROL lipaseclosedform https://refubium.fu-berlin.de/handle/fub188/51570?locale-attribute=de Refubium - Chemical Probes for Translational Research on Monoacylglycerol Lipase chemical probestranslational researchlipase https://cordis.europa.eu/project/id/101152937/de Lipase immobilization for microscopic investigation of enzyme activity | lipaseTEM | Projekt |... Water contamination caused by human and industrial activities is a significant global concern. One of the most prominent pollutants is oily wastewater,... enzyme activitylipaseimmobilizationmicroscopicinvestigation https://www.canada.ca/en/health-canada/services/food-nutrition/public-involvement-partnerships/modification-permitted-food-enzymes-lipase.html Notice of Modification to the List of Permitted Food Enzymes to Enable the Use of Lipase from... Notice of Modification to the List of Permitted Food Enzymes to Enable the Use of Lipase from Trichoderma reesei Morph Lip3 in Bread, Flour, Whole Wheat Flour,... to the list https://publications-cnrc.canada.ca/eng/view/object/?id=1922eaf5-f1d0-4953-a259-532c8df79f37 Purification and characterization of a Penicillium sp. lipase which discriminates against... Purification and characterization of a Penicillium sp. lipase which discriminates against diglycerides of apurificationcharacterization https://pubmed.ncbi.nlm.nih.gov/17259660/ Retroperitoneal white adipose tissue lipoprotein lipase activity is rapidly down-regulated in... Tissue-specific regulation of LPL has been widely studied in rats. Previous studies reported that in vivo administration of adrenaline and acute stress cause... adipose tissuelipoprotein lipase https://www.semanticscholar.org/topic/bile-salt-stimulated-lipase/3300013 bile salt-stimulated lipase | Semantic Scholar bilesaltstimulatedlipasesemantic https://agris.fao.org/search/en/providers/122436/records/67597d99c7a957febdf8d097 Incorporation of capric acid in pumpkin seed oil by sn-1,3 regioselective lipase-catalyzed... https://nrc-publications.canada.ca/fra/voir/objet/?id=e504ac0f-e267-4792-9b7f-0b41f5f36748 Polymorphism in the lipase genes of Geotrichum candidum strains - Archives des publications du CNRC... Polymorphism in the lipase genes of Geotrichum candidum strains https://boris-portal.unibe.ch/entities/publication/781261a3-ac8c-4889-84ca-abfc50e532b3 DAG Lipase Involvement in Depolarization-Induced Suppression of Inhibition: Does Endocannabinoid... daglipaseinvolvementdepolarization https://iris.cnr.it/handle/20.500.14243/368041 Frozen microemulsions for MAPLE immobilization of lipase frozenmicroemulsionsmapleimmobilizationlipase https://pubs.rsc.org/en/Content/ArticleLanding/2022/SC/D1SC05660C Lipase-catalyzed esterification in water enabled by nanomicelles. Applications to 1-pot multi-step... Esterification in an aqueous micellar medium is catalyzed by a commercially available lipase in the absence of any co-factors. The presence of only 2 wt%... https://publications-cnrc.canada.ca/eng/view/object/?id=367a615b-9e90-4cbc-9c6b-7078f1a6ec37 Expression and characterization of Geotrichum candidum lipase I gene. Comparison of specificity... Expression and characterization of Geotrichum candidum lipase I gene. Comparison of specificity profile with lipase II expressioncharacterization https://pubchem.ncbi.nlm.nih.gov/protein/EC:3.1.1.3 Triacylglycerol lipase (EC 3.1.1.3) | Protein Target - PubChem Protein enzyme information for 3.-.-.- Hydrolases | 3.1.-.- Acting on ester bonds | 3.1.1.- Carboxylic ester hydrolases. Find compounds, bioassays, and... lipaseecproteintargetpubchem https://www.ncbi.nlm.nih.gov/gene/69060 Pnlip pancreatic lipase [Mus musculus (house mouse)] - Gene - NCBI mus musculushouse mousepancreaticlipasegene https://pubs.rsc.org/en/content/articlelanding/2016/fo/c5fo00930h Relevant pH and lipase for in vitro models of gastric digestion - Food & Function (RSC Publishing) The development of in vitro digestion models relies on the availability of in vivo data such as digestive enzyme levels and pH values recorded in the course of... https://pubmed.ncbi.nlm.nih.gov/10787434/ Two novel mutations in the lipoprotein lipase gene in a family with marked hypertriglyceridemia in... Two novel mutations in the lipoprotein lipase (LPL) gene are described in an Austrian family: a splice site mutation in intron 1 (3 bp deletion of nucleotides... https://www.ncbi.nlm.nih.gov/gene/67717 Lipf lipase F, gastric type [Mus musculus (house mouse)] - Gene - NCBI mus musculushouse mouselipflipasegastric https://iris.cnr.it/handle/20.500.14243/454143 Mono- and disaccharides enhance the activity and enantioselectivity of Burkholderia cepacia lipase... monoenhance https://pubmed.ncbi.nlm.nih.gov/25529980/ The galactolipase activity of Fusarium solani (phospho)lipase The purified (phospho)lipase of Fusarium solani (FSL), was known to be active on both triglycerides and phospholipids. This study aimed at assessing the... activityfusariumsolaniphospholipase https://agris.fao.org/search/en/providers/122535/records/65df7fe490674e46e653ba87 Lipase production by Aspergillus terreus using mustard seed oil cake as a carbon source https://uwspace.uwaterloo.ca/items/5bc9a30f-17ce-4605-8147-2b2ab9cc3f87 Identification of Factors Limiting Heterologous Lipase Expression in the Cytoplasm and the... Lipase B from Pseudozyma antarctica (PalB), had been expressed in several recombinant protein hosts and showed very good transesterification activity for... in theidentificationfactorslimiting https://dspace.rpi.edu/items/553f1816-dc2e-4688-b7f0-0ce0c1bc8f61 Lipase-catalyzed biodegradable polyol polyester synthesis and characterization The lack of tough biodegradable elastomers underlies one of the most complicated and intriguing challenges in modern bioengineering, the search for affordable... lipasebiodegradablepolyolpolyestersynthesis https://pubchem.ncbi.nlm.nih.gov/protein/P29183 Pancreatic triacylglycerol lipase (horse) | Protein Target - PubChem Protein target information for Pancreatic triacylglycerol lipase (horse). Find diseases associated with this biological target and compounds tested against it... pancreaticlipasehorseproteintarget https://cordis.europa.eu/project/id/101148076/es Regulation of hormone-sensitive lipase in neurons | RELINEU | Proyecto | Ficha informativa |... Several lipids and lipid-derived molecules play crucial roles in regulating brain function, affecting synaptic activity and plasticity, cerebral blood flow... regulationhormonesensitivelipase https://publications-cnrc.canada.ca/eng/view/object/?id=e6029342-f41e-45e3-8d9c-94b5304062ac Two conformational states of Candida rugosa lipase - NRC Publications Archive - Canada.ca Two conformational states of Candida rugosa lipase https://uwspace.uwaterloo.ca/items/bdbf9d3e-534e-4fdc-ac90-f8fa31aca16e Synthesis of Sugar Fatty Acid Esters using Lipase Immobilized in Supported Sol-Gels Sugar fatty acid esters are of practical importance and have a variety of applications that include biodegradable detergents and emulsifiers in resin... fatty acid esters https://eric.ed.gov/?id=EJ1279724 ERIC - EJ1279724 - Hydrolysis of Triglycerides in Cream Using Porcine Pancreatic Lipase, Journal of... The development of an enzyme-mediated reaction for the first-year general, organic, and biological chemistry (GOB) teaching laboratory is of significant... https://www.ncbi.nlm.nih.gov/Structure/pdb/6KSL 6KSL: Staphylococcus aureus lipase - S116A inactive mutant Lipase 2CALCIUM IONLAURIC ACIDZINC IONbutanoic acid staphylococcus aureuslipaseinactivemutant https://scholars.uky.edu/es/publications/effect-of-feeding-and-obesity-on-lipoprotein-lipase-activity-immu/fingerprints/ Effect of feeding and obesity on lipoprotein lipase activity, immunoreactive protein, and messenger... https://pmc.ncbi.nlm.nih.gov/articles/PMC4477989/ Lipase Supplementation before a High-Fat Meal Reduces Perceptions of Fullness in Healthy Subjects -... Postprandial symptoms of fullness and abdominal discomfort are common after fatty meals. Gastric lipases hydrolyze 10% to 20% of dietary triglycerides during... https://scholars.uky.edu/en/publications/purification-and-characterization-of-lipase-from-rhizomucor-miehe/ Purification and Characterization of Lipase from Rhizomucor miehei - University of Kentucky purificationcharacterizationlipaseuniversitykentucky https://www.canada.ca/en/health-canada/services/food-nutrition/public-involvement-partnerships/modification-list-permitted-food-enzymes-use-lipase-mucor-javanicusas-food-enzyme-dairy-based-flavouring.html Notice of Modification to the List of Permitted Food Enzymes to Enable the Use of Lipase Obtained... 2014 Health Canada Notice of Modification to the list of permitted food enzymes to the list https://www.techtransfer.nih.gov/patent/e-007-2003-2-pct-01 Synthesis Of The Monoester Of 1,3 Butandiol With A Trimer Of D-Beta-Hydroxybutayrate Using Lipase... https://eprints.soton.ac.uk/427589/ Lipase-catalyzed dynamic kinetic resolution of C 1 - and C 2 -symmetric racemic axially chiral... https://pmc.ncbi.nlm.nih.gov/articles/PMC41964/ A mutation in the promoter of the lipoprotein lipase (LPL) gene in a patient with familial combined... We have identified a naturally occurring mutation in the promoter of the lipoprotein lipase (LPL) gene. One of 20 patients with familial combined... https://nrc-publications.canada.ca/eng/view/object/?id=e6029342-f41e-45e3-8d9c-94b5304062ac Two conformational states of Candida rugosa lipase - NRC Publications Archive - Canada.ca Two conformational states of Candida rugosa lipase https://cordis.europa.eu/project/id/101152937/results/pl Lipase immobilization for microscopic investigation of enzyme activity | lipaseTEM | Projekt |... Deliverables, publications, datasets, software, exploitable results enzyme activitylipaseimmobilizationmicroscopicinvestigation https://miun.diva-portal.org/smash/record.jsf?pid=diva2:27316 Synthesis and lipase catalysed stereoselective acylation of some 3-methyl-2-alkanols, identified as... https://scholars.lib.ntu.edu.tw/entities/project/3d9d57ab-310f-405b-bc32-dfbe97f38fa8 Activity and Molecular Genetic Study of Lipoprotein Lipase in Hyperlipidemia and Combined... molecular geneticlipoprotein lipaseactivitystudy https://theses.gla.ac.uk/78397/ Lipase-Catalysed Biotransformations in Organic Synthesis - Enlighten Theses organic synthesislipaseenlightentheses https://www.canada.ca/en/health-canada/services/food-nutrition/public-involvement-partnerships/notice-modification-list-permitted-food-enzymes-lipase-mucor-circinelloide-certain-cheeses.html Notice of Modification to the List of Permitted Food Enzymes to Enable the Use of Lipase from Mucor... Notice of Modification to the List of Permitted Food Enzymes to Enable the Use of Lipase from Mucor circinelloides f. circinelloides AE-LM in Certain Cheeses -... https://pmc.ncbi.nlm.nih.gov/articles/PMC15409/ Targeted disruption of hormone-sensitive lipase results in male sterility and adipocyte... Hormone-sensitive lipase (HSL) is known to mediate the hydrolysis not only of triacylglycerol stored in adipose tissue but also of cholesterol esters in the... https://www.mdpi.com/2072-6643/16/15/2566 Discovery of Curcuminoids as Pancreatic Lipase Inhibitors from Medicine-and-Food Homology Plants Researchers are increasingly interested in discovering new pancreatic lipase inhibitors as anti-obesity ingredients. Medicine-and-food homology plants contain... https://pmc.ncbi.nlm.nih.gov/articles/PMC23991/ Arabidopsis thaliana PAD4 encodes a lipase-like gene that is important for salicylic acid signaling... The Arabidopsis PAD4 gene previously was found to be required for expression of multiple defense responses including camalexin synthesis and PR-1 gene... https://scholars.uky.edu/en/publications/purification-and-characterization-of-lipase-from-rhizomucor-miehe/fingerprints/ Purification and Characterization of Lipase from Rhizomucor miehei - Fingerprint - University of... purificationcharacterizationlipasefingerprintuniversity https://pubmed.ncbi.nlm.nih.gov/9738727/ Familial lipoprotein lipase deficiency in infancy: clinical, biochemical, and molecular study The presentation of LPL deficiency is heterogeneous during infancy. Close dietary monitoring is required to avoid nutritional deficiencies. Estrogen therapy... lipoprotein lipasefamilialdeficiency https://profiles.wustl.edu/en/publications/sn2-lipase-labile-prodrugs-and-contact-facilitated-drug-delivery-/ Sn2 lipase labile prodrugs and contact-facilitated drug delivery for lipid-encapsulated... https://my.clevelandclinic.org/health/diagnostics/lipase-blood-test Lipase Blood Test: What It Is & Understanding the Results A lipase blood test shows how much of the pancreatic enzyme lipase you have in your blood. Extremely high levels may signal acute pancreatitis. what it isblood testlipaseunderstandingresults https://www.canada.ca/en/health-canada/services/food-nutrition/legislation-guidelines/acts-regulations/notices-proposal-notices-modification/list-permitted-enzymes-authorize-use-lipase-from-new-source.html Modification to the List of Permitted Food Enzymes to authorize the use of lipase from a new source... Notice of modification to the List of Permitted Food Enzymes to authorize the use of lipase from a new source https://pubmed.ncbi.nlm.nih.gov/12919138/?dopt=Abstract Cholesterol ester transfer protein, apolipoprotein E and lipoprotein lipase genotypes in patients... The aim of this study was to compare patients with coronary artery disease (CAD) to healthy objects, in order to explore a possible association between CAD and... apolipoprotein e https://publications-cnrc.canada.ca/eng/view/object/?id=26756c91-9d3f-4401-bc4d-286a5fab17f1 Determination of lipase activity by a rhodamine-triglyceride-agarose assay - NRC Publications... Determination of lipase activity by a rhodamine-triglyceride-agarose assay by a https://nrc-publications.canada.ca/fra/voir/objet/?id=c95eb07a-a68e-4d82-a501-e00d55ed31db Structure and conformational flexibility of Candida rugosa lipase - Archives des publications du... Structure and conformational flexibility of Candida rugosa lipase archives des publications https://pubmed.ncbi.nlm.nih.gov/1975597/ A missense mutation at codon 188 of the human lipoprotein lipase gene is a frequent cause of... Lipoprotein lipase (LPL) plays a crucial role in the regulation of lipoprotein metabolism by hydrolysing the core triglycerides of circulating chylomicrons and... https://pubmed.ncbi.nlm.nih.gov/24742138/ Lyotropic liquid crystalline nanoparticles of CoQ10: implication of lipase digestibility on oral... The present investigation reports implications of the lipase digestibility of lyotropic liquid crystalline nanoparticles (LCNPs) on the oral bioavailability,... liquidcrystallinenanoparticles https://phytochem.nal.usda.gov/activity-lipase-inhibitor Biological Activity Lipase-Inhibitor | Dr. Duke's Phytochemical and Ethnobotanical Databases biological activitylipaseinhibitordr https://www.ncbi.nlm.nih.gov/gene/938389 estA secreted alkaliphilic lipase [Bacillus subtilis subsp. subtilis str. 168] - Gene - NCBI bacillus subtilisestasecretedlipase https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=7f16f2d4-8df6-4bd7-ac10-56994fa257b0&audience=consumer DailyMed - ZENPEP- pancrelipase lipase, pancrelipase protease, pancrelipase amylase capsule,... dailymedlipaseproteaseamylasecapsule https://www.canada.ca/en/health-canada/services/food-nutrition/public-involvement-partnerships/modification-permitted-food-enzymes-bakery-products.html Notice of Modification to the List of Permitted Food Enzymes to Enable the Use of Lipase - Canada.ca Notice of Modification to the List of Permitted Food Enzymes to Enable the Use of Lipase Reference NOM/ADM 0123 https://pure.psu.edu/en/publications/ultrasonic-enhancement-of-lipase-catalyzed-transesterification-fo/ Ultrasonic enhancement of lipase-catalyzed transesterification for biodiesel production from used... biodiesel productionultrasonicenhancementlipase https://pubmed.ncbi.nlm.nih.gov/24792990/ Lysosomal acid lipase deficiency--an under-recognized cause of dyslipidaemia and liver dysfunction Lysosomal acid lipase deficiency (LAL-D) is a rare autosomal recessive lysosomal storage disease caused by deleterious mutations in the LIPA gene. The age at... https://cme.uchicago.edu/hospital-medicine-continuous-professional-development-series---rss-10-00-007-fy24/content/tba-14304 Lipase elevation beyond the Pancreas and Pancreatitis | Center for Continuing Medical Education Learning Objective 1: Discuss etiologies of lipase elevation.Learning Objective 2: Provide overview of the diagnosis and etiologies of acute... the pancreas https://pure.psu.edu/en/publications/milk-lipoprotein-lipase-activity-during-long-term-administration-/ Milk Lipoprotein Lipase Activity During Long-Term Administration of Recombinant Bovine Somatotropin... lipoprotein lipaselong term https://nrc-publications.canada.ca/eng/view/object/?id=8704e923-6097-4b9c-8783-974fafefee8a Distribution of lipase in milk proteins. I. DEAE cellulose column chromatography - NRC Publications... Distribution of lipase in milk proteins. I. DEAE cellulose column chromatography https://pubchem.ncbi.nlm.nih.gov/protein/D4A9L7 Lipase (Norway rat) | Protein Target - PubChem Protein target information for Lipase (Norway rat). Find diseases associated with this biological target and compounds tested against it in bioassay... norway ratlipaseproteintargetpubchem https://pmc.ncbi.nlm.nih.gov/articles/PMC151857/ Endothelial lipase is a major determinant of HDL level - PMC A new member of the lipase gene family, initially termed endothelial lipase (gene nomenclature, LIPG; protein, EL), is expressed in a variety of different... endothelial lipasemajordeterminanthdllevel https://pubchem.ncbi.nlm.nih.gov/protein/Q9N2Z4 Lipase_GDSL domain-containing protein (Caenorhabditis elegans) | Protein Target - PubChem Protein target information for Lipase_GDSL domain-containing protein (Caenorhabditis elegans). Find diseases associated with this biological target and... caenorhabditis eleganslipasegdsldomaincontaining https://pubchem.ncbi.nlm.nih.gov/protein/A4VL35 Lipase chaperone (Stutzerimonas stutzeri A1501) | Protein Target - PubChem Protein target information for Lipase chaperone (Stutzerimonas stutzeri A1501). Find diseases associated with this biological target and compounds tested... lipasechaperoneproteintargetpubchem https://www.wikidata.org/wiki/Q69608002 Detection and characterization of the heterozygote state for lipoprotein lipase deficiency -... scientific article published on 01 May 1989 of thelipoprotein lipasedetectioncharacterization https://lipoeasee.co.uk/ LipoEase UK: Advanced Lipase Testing and Pancreatic Health Solutions LipoEase Weight Loss presents a compelling option for those seeking an effective weight loss supplement that also enhances overall well-being. Its blend of... pancreatic healthukadvancedlipasetesting https://www.news-medical.net/whitepaper/20220329/Monitoring-the-relationship-between-Endothelial-Lipase-and-HDL-by-NMR-2.aspx Monitoring the relationship between Endothelial Lipase and HDL by NMR Dec 16, 2025 - High-density lipoprotein (HDL) performs anti-oxidative, anti-inflammatory, and cholesterol efflux functions. Therefore, a high level of HDL is considered... the relationshipendothelial lipasemonitoringhdlnmr https://pubmed.ncbi.nlm.nih.gov/15812860/ Properties of a thermostable extracellular lipase from Bacillus megaterium AKG-1 An extracellular lipase isolated from Bacillus megaterium AKG-1 had an optimum activity at 55 degrees C/pH 7.0. It retained 100% activity at 50 degrees C for... of abacillus megateriumpropertiesextracellular https://pubmed.ncbi.nlm.nih.gov/27031275/ Role of lipoprotein lipase in lipid metabolism The LPL system is central in energy metabolism and results from interplay between several factors. Rapid and exciting progress is being made. lipoprotein lipaserolelipidmetabolism https://pubmed.ncbi.nlm.nih.gov/18649389/ Lipoprotein lipase variants associated with an endophenotype of hypertension: hypertension combined... Previously, we observed that young-onset hypertension was independently associated with elevated plasma triglyceride(s) (TG) levels to a greater extent than... lipoprotein lipaseassociated withvariantshypertensioncombined https://pubchem.ncbi.nlm.nih.gov/protein/H2KY93 Lipase_3 domain-containing protein (Caenorhabditis elegans) | Protein Target - PubChem Protein target information for Lipase_3 domain-containing protein (Caenorhabditis elegans). Find diseases associated with this biological target and compounds... caenorhabditis eleganslipasedomaincontainingprotein https://pubmed.ncbi.nlm.nih.gov/25123816/ Lipase-mediated lipid removal from propolis extract and its antiradical and antimicrobial activity Lipozyme TL IM treatment effectively removes lipids from propolis extract and enhances antibacterial activity. Therefore, we suggest that Lipozyme TL IM is a... propolis extract https://www.semanticscholar.org/topic/Monoester-Lipase/6399482 Monoester Lipase | Semantic Scholar lipasesemanticscholar https://profiles.nlm.nih.gov/spotlight/bb/catalog/nlm:nlmuid-101584906X8279-doc Purified Pancreatic Lipase - Joshua Lederberg - Profiles in Science purifiedpancreaticlipasejoshuaprofiles https://research.monash.edu/en/publications/ultrasonic-enhancement-of-lipase-catalysed-transesterification-fo/ Ultrasonic enhancement of lipase-catalysed transesterification for biodiesel synthesis - Monash... ultrasonicenhancementlipasetransesterificationbiodiesel https://publica.fraunhofer.de/entities/publication/341be7da-6ffc-4546-90b7-0e24fa798cca Optimization of the lipase mediated epoxidation of monoterpenes using the design of... This work deals with the optimization of the Candida antartica lipase B (CALB) mediated epoxidation of monoterpenes by using the design of experiments (DoE)... of theoptimizationlipasemediatedusing https://pubmed.ncbi.nlm.nih.gov/8970745/ Enantiomeric perylene-glycerolipids as fluorogenic substrates for a dual wavelength assay of lipase... A new type of fluorogenic alkyldiacyl glycerols was synthesized and used as fluorogenic substrates for the analysis of lipase activities and... https://pearltrial.ucsf.edu/lysosomal-acid-lipase-deficiency-wolman-disease Lysosomal Acid Lipase Deficiency (Wolman disease) | Prenatal Enzyme Replacement for Lysosomal... enzyme replacementacidlipasedeficiencywolman https://nrc-publications.canada.ca/eng/view/object/?id=4f57ca1e-7b8b-4ce7-a4d2-2f1ba139a29d High level expression of lipase in Pichia pastoris using methanol probe to maintain metehanol... High level expression of lipase in Pichia pastoris using methanol probe to maintain metehanol concentration in high cell density bioreactor https://www.ncbi.nlm.nih.gov/gene/5856510 MGL_0797 LIP1, secretory lipase (family 3) [Malassezia globosa CBS 7966] - Gene - NCBI https://www.wikidata.org/wiki/Q54130972 Activation and phosphorylation of purified adipose tissue hormone-sensitive lipase by cyclic... adipose tissue https://www.ncbi.nlm.nih.gov/Structure/pdb/1R50 1R50: Bacillus subtilis lipase A with covalently bound Sc-IPG-phosphonate-inhibitor Lipase[(4S)-2,2-DIMETHYL-1,3-DIOXOLAN-4-YL]METHYL HYDROGEN HEX-5-ENYLPHOSPHONATE bacillus subtilis https://file.scirp.org/Html/13-2700800_35282.htm Effect of Homogenization Temperature and Pressure on Lipoprotein Lipase Activity and Free Fatty... https://kb.wisc.edu/dairynutrient/875RNP/feedback.php?action=2&help=comment&id=56254 Feedback: LIPASE feedbacklipase