Robuta

https://pubmed.ncbi.nlm.nih.gov/37873793/ Transient Leukemoid Reaction from T-Cell Large Granular Lymphocytes Post Autologous Stem Cell... Monoclonal T-cell lymphocytosis has been reported in patients with concomitant autoimmune diseases, viral infections, or immunodeficiencies. Referred to as... transientreactioncelllargegranular https://research.brighton.ac.uk/en/publications/werners-syndrome-t-lymphocytes-display-a-normal-in-vitro-life-spa/fingerprints/ Werner's syndrome T lymphocytes display a normal in vitro life-span - Fingerprint - The University... in vitrolife spanthe universitywernersyndrome https://journals.rudn.ru/medicine/article/view/46817 Dynamics of morphometric and optical parameters of rat lymphocytes under the influence of... Dynamics of morphometric and optical parameters of rat lymphocytes under the influence of copper-zinc pyrite ore under the influencedynamicsopticalparametersrat https://experts.arizona.edu/en/publications/expression-of-il-2-and-il-4-in-t-lymphocytes-transformed-by-herpe/ Expression of IL-2 and IL-4 in T Lymphocytes Transformed by Herpesvirus Saimiri - University of... expressionillymphocytestransformeduniversity https://journals.plos.org/plosone/article?id=10.1371%2Fjournal.pone.0259910 Atypical lymphocytes in the peripheral blood of COVID-19 patients: A prognostic factor for the... Background Clinical observations have shown that there is a relationship between coronavirus disease 2019 (COVID-19) and atypical lymphocytes in the peripheral... the peripheralatypicallymphocytesbloodcovid https://oa-fund.ub.uni-muenchen.de/id/eprint/2441/ Prognostic value of tumor-infiltrating lymphocytes, tumor associated neutrophils and metabolic... valuetumorlymphocytesassociatedneutrophils https://portal.fis.tum.de/de/publications/infiltration-patterns-of-macrophages-and-lymphocytes-in-chronical/ Infiltration patterns of macrophages and lymphocytes in chronically rejecting rat kidney allografts... infiltrationpatternsmacrophageslymphocyteskidney https://repub.eur.nl/pub/36361 RePub, Erasmus University Repository: Influenza virus-specific cytotoxic T lymphocytes: a correlate... influenza viruserasmusuniversityrepositoryspecific https://cancer.osu.edu/for-patients-and-caregivers/learn-about-cancers-and-treatments/innovation-at-the-james/clinical-trials/find-a-clinical-trial/a-phase-iii-openlabel-study-of-pd1-knockout A Phase I/II, Open-Label Study of PD-1 Knockout Tumor-Infiltrating Lymphocytes (IOV-4001) in... A Phase I/II, Open-Label Study of PD-1 Knockout Tumor-Infiltrating Lymphocytes (IOV-4001) in Participants with Unresectable or Metastatic Melanoma or Stage III... phase iiiopenlabelstudy https://ricerca.uniparthenope.it/handle/11367/29502 Effects of insulin-like growth factor I abuse on human lymphocytes effectsinsulinlikegrowthfactor https://iris.unito.it/handle/2318/1792133 Recruitment, infiltration and cytotoxicity of hla-independent killer lymphocytes in... recruitmentinfiltrationcytotoxicityhlaindependent https://www.diagenode.com/en/publications/view/1557 Pattern of heat shock factor and heat shock protein expression in lymphocytes of bipolar patients:... Bipolar disorder (BD), a stress-related disease, is characterized by altered glucocorticoid receptor (GR) signalling. Stress response includes acti... protein expressionpatternheatshockfactor https://www.frontiersin.org/journals/physiology/articles/10.3389/fphys.2025.1520174/full Frontiers | Interleukins expression by rat Lymphocytes exposed to chronic intermittent normobaric... Acute and chronic hypoxia modulate the expression of inflammatory mediators known as cytokines. However, studies in chronic and intermittent hypobaric or nor... frontiersinterleukinsexpressionratlymphocytes https://profiles.wustl.edu/en/publications/congenital-pancytopenia-and-absence-of-b-lymphocytes-in-a-neonate/fingerprints/?sortBy=alphabetically Congenital pancytopenia and absence of B lymphocytes in a neonate with a mutation in the ikaros... in acongenitalpancytopeniaabsencelymphocytes https://www.iris.unicz.it/handle/20.500.12317/73926 Tumor-infiltrating lymphocytes and POLE mutation in endometrial carcinoma tumorlymphocytespolemutationendometrial https://www.omicsonline.org/proceedings/b-lymphocytes-regulate-a-proinflammatory-t-cell-balance-in-human-type-2-diabetes-9234.html B Lymphocytes Regulate A Pro-inflammatory T Cell Balance In Human Type 2 Diabetes | 9234 Lymphocytes play key roles in the chronic inflammation critical for T2D pathogenesis. We have shown T2D patients have an elevated ratio of pro- to... blymphocytesregulateproinflammatory https://christie.openrepository.com/entities/publication/90a41fd8-a453-465f-90d1-fc51509cda2c Gene therapy of patient-derived T lymphocytes to target and eradicate colorectal hepatic metastases. PURPOSE: The overall aim of this study was to develop a novel treatment for colorectal cancer based on the use of gene therapy. Genetic modification of T... gene therapypatientderivedlymphocytestarget https://repositorio.bc.ufg.br/items/8ffe576c-2bbe-4a6d-9292-7df5f04050e6 DNA damage in peripheral blood lymphocytes and association with polymorphisms in the promoter... DNA damage caused by the accumulation of bio-products generated in the biotransformation of ethanol to acetaldehyde mediated by the CYP2E1 enzyme has been... dna damageassociation withperipheralbloodlymphocytes https://discovery.researcher.life/article/quantifications-of-cd4-t-lymphocytes-levels-in-adult-sickle-cell-patients-examining-immunological-vulnerability-and-vaso-occlusive-crises-in-a-low-resource-setting-northwestern-nigeria/2c6cb03e2c60347e9e241ea730d04666 Quantifications of CD4+ T-Lymphocytes levels in adult sickle cell patients: Examining immunological... Article on Quantifications of CD4+ T-Lymphocytes levels in adult sickle cell patients: Examining immunological vulnerability and Vaso-Occlusive crises in a... sickle celllymphocyteslevelsadultpatients https://research.hub.ku.edu.tr/entities/publication/5db3b663-89ff-43f4-a4a1-b467743a18e9 The effect of neoadjuvant chemotherapy on tumor-infiltrating lymphocytes in patients with breast... Aim: This study investigated the effect of neoadjuvant chemotherapy (NAC) on stromal tumor-infiltrating lymphocytes (sTILs) and their treatment response.... the effectneoadjuvant chemotherapyin patientstumorlymphocytes https://ricerca.univaq.it/handle/11697/5522 Gamma-Delta T lymphocytes in HIV-infected patients delta tgammalymphocyteshivinfected https://scholars.houstonmethodist.org/en/publications/autoreactive-t-and-b-lymphocytes-in-myasthenia-gravis-phd-thesis/ Autoreactive T and B lymphocytes in myasthenia gravis (PhD Thesis). - Houston Methodist Scholars myasthenia gravisphd thesishouston methodistblymphocytes https://mouseion.jax.org/ssbb1976/3053/ "The kinetics of interferon production by mouse lymphocytes and its mod" by J W. Heine and W H.... By J W. Heine and W H. Adler, Published on 01/01/76 j wkineticsinterferonproductionmouse https://shop.elsevier.com/books/handbook-of-b-and-t-lymphocytes/snow/978-0-12-653955-4 Handbook of B and T Lymphocytes - 1st Edition | Elsevier Shop handbooklymphocyteseditionelseviershop https://cris.huji.ac.il/en/publications/e-receptors-mediate-the-attachment-of-activated-t-lymphocytes-to-/ E-receptors mediate the attachment of activated T-lymphocytes to human red blood cells: Evidence... red blood cellsreceptorsmediateattachmentactivated https://researchconnect.stonybrook.edu/en/publications/chromosome-aberrations-in-lymphocytes-of-persons-exposed-to-an-ea/ Chromosome aberrations in lymphocytes of persons exposed to an earthquake in Armenia - Stony Brook... stony brookchromosomeaberrationslymphocytespersons https://eprints.lib.hokudai.ac.jp/repo/huscap/all/2999/ NONSPECIFIC CELL-MEDIATED CYTOTOXICITY OF PERIPHERAL BLOOD LYMPHOCYTES DERIVED FROM SUCKLING... cellmediatedcytotoxicityperipheralblood https://cuk.elsevierpure.com/en/publications/efficient-generation-of-survivin-specific-cytotoxic-t-lymphocytes/ Efficient generation of survivin-specific cytotoxic T lymphocytes from healthy persons in vitro:... in vitroefficientgenerationspecificcytotoxic https://medicine.yale.edu/bbs/research-profiles/?orgId=109532&meshId=13016 Researchers interested in T-Lymphocytes, Cytotoxic | Biological & Biomedical Sciences Researchers interested in T-Lymphocytes, Cytotoxic interested inbiomedical sciencesresearcherslymphocytescytotoxic https://edumanias.com/health/10-benefits-of-maintaining-normal-range-of-lymphocytes-in-women/ 10 Benefits Of Maintaining Normal Range Of Lymphocytes In Women? benefits ofmaintainingnormalrangelymphocytes https://ijomeh.eu/Assessment-of-dna-damage-using-chromosomal-aberrations-assay-in-lymphocytes-of-waterpipe-smokers,2249,0,2.html Assessment of DNA damage using chromosomal aberrations assay in lymphocytes of waterpipe smokers Objectives: The aim of this study was to investigate the genotoxicity of waterpipe smoking in the lymphocytes of waterpipe smokers using chromosomal... dna damageassessmentusingaberrationsassay https://phototheque.unige.ch/unige:160902 Les lymphocytes tueurs (en vert) attaquent les vaisseaux lymphatiques (en rouge) dans la tumeur,... dans laleslymphocytesenvert https://journal.ugm.ac.id/TradMedJ/article/view/95105/41462 Immunostimulatory Effects of Zingiber ottensii Rhizome Extract on Mouse Lymphocytes and Peritoneal... Immunostimulatory Effects of Zingiber ottensii Rhizome Extract on Mouse Lymphocytes and Peritoneal Macrophages effectszingiberrhizomeextractmouse https://www.mathewsopenaccess.com/journals/immunology-allergy/abstract/the-sea-star-lymphocytes-a-reply-to-evolutionary-immunologists The Sea Star Lymphocytes: A Reply to Evolutionary Immunologists The Sea Star Lymphocytes: A Reply to Evolutionary Immunologists the seareply tostarlymphocytesevolutionary https://investigadores.uandes.cl/es/publications/fas-ligandsupsup-fallopian-tube-epithelium-induces-apoptosis-in-b-4/ Fas ligand+ fallopian tube epithelium induces apoptosis in both Fas receptor+ T lymphocytes and... fallopian tubefasligandepitheliuminduces https://ircommons.uwf.edu/esploro/outputs/journalArticle/The-role-of-adipose-tissue-associated-macrophages/99380580794806600 The role of adipose tissue-associated macrophages and T lymphocytes in the pathogenesis of... Inflammatory bowel diseases (IBDs) are chronic inflammatory disorders of the gastrointestinal tract that affect more than 3 million people worldwide, but the... role ofadipose tissueassociatedmacrophageslymphocytes https://www.wikidata.org/wiki/Q36192016 Human monocytes and macrophages. Interaction with antigen and lymphocytes - Wikidata scientific article published on July 1, 1970 humanmonocytesmacrophagesinteractionantigen https://jbcr.arphahub.com/article/34709/list/18/ A Study on Tumor-Infiltrating Lymphocytes in Different Subtypes of Breast Cancer The study aimed to investigate immune cell infiltration in different subtypes of breast cancer (BC). Retrospectively were selected 100 patients with primary... a studybreast cancertumorlymphocytesdifferent https://collaborate.princeton.edu/en/publications/an-activation-to-memory-differentiation-trajectory-of-tumor-infil/ An activation to memory differentiation trajectory of tumor-infiltrating lymphocytes informs... activationmemorydifferentiationtrajectorytumor https://www.marham.pk/forum/general-physician/atypical-lymphocytes-seen-178184 Ask a General Physician Online for Atypical Lymphocytes Seen Atypical Lymphocytes Seen. Ask Health related questions from verified Doctors for FREE and get quick medical advice for your health queries. general physicianaskonlineatypicallymphocytes https://www.homenaturalcures.com/tag/3-ways-to-increase-lymphocytes/ 3 Ways To Increase Lymphocytes Archives - Home Remedies And Natural Treatments In USA Home Remedies and natural treatments are the best alternative therapies which does not have much side effects, and helps to lead a healthy and happy life. home remediesnatural treatmentsin usawaysincrease https://www.univ-brest.fr/lbai/en/membre/sophie-hillion Sophie Hillion | B Lymphocytes, Autoimmunity and Immunotherapies - UMR 1227 sophiehillionblymphocytesautoimmunity https://idus.us.es/items/f8fb5204-eca2-4a51-aaa3-5fa80cb920b6 Could the Adoptive Transfer of Memory Lymphocytes be an Alternative Treatment for Acinetobacter... We evaluated the efficacy of the adoptive transfer of memory B, CD4+, and CD8+ T lymphocytes compared with sulbactam and tigecycline in an experimental murine... an alternativetreatment forcouldtransfermemory https://repository.icesi.edu.co/items/5f9b8cea-4155-7785-e053-2cc003c84dc5 B lymphocytes: development, tolerance, and their role in autoimmunity-focus on systemic lupus... B lymphocytes are the effectors of humoral immunity, providing defense against pathogens through different functions including antibody production. B cells... focus onblymphocytesdevelopmenttolerance https://jlupub.ub.uni-giessen.de/items/e17f5ccd-352f-4c83-bb57-0c12363fa13a Regulation of the opioid precursor proopiomelanocortin in lymphocytes in a rat model of... Proopiomelanocortin (POMC) is a precursor protein for many peptide hormones such as adrenocorticotropic hormone (ACTH), melanocyte-stimulating hormones (MSH)... regulationopioidprecursorlymphocytesrat https://jpmph.org/journal/view.php?number=124 Concentration of Urinary Cotinine and Frequency of Sister Chromatid Exchange in Lymphocytes among... concentrationurinarycotininefrequencysister https://www.immunologypodcast.com/category/lymphocytes Lymphocytes - The Immunology Podcast the immunology podcastlymphocytes https://scholars.mssm.edu/en/publications/swift-entry-of-myelin-specific-t-lymphocytes-into-the-central-ner-2/ Swift entry of myelin-specific T lymphocytes into the central nervous system in spontaneous... central nervous systemswiftentrymyelinspecific https://www.letstalkacademy.com/autocrine-signaling-in-t-lymphocytes-mechanism-of-immune-response-amplification/ Autocrine Signaling in T Lymphocytes: Mechanism of Immune Response Amplification - CSIR NET LIFE... Oct 16, 2025 - Explore how T lymphocytes use autocrine signaling to produce growth factors that promote their own proliferation, boosting antigen-specific immune responses.... autocrine signalingimmune responsecsir netlymphocytesmechanism https://virtual.keystonesymposia.org/p/a/atypical-lymphocytes-in-lymphoid-and-non-lymphoid-organs-were-the-major-targets-of-sftsv-infection-in-humans-10103 Atypical Lymphocytes in Lymphoid and Non-Lymphoid Organs were the Major Targets of SFTSV Infection... ATYPICAL LYMPHOCYTES IN LYMPHOID AND NON-LYMPHOID ORGANS WERE THE MAJOR TARGETS OF SFTSV INFECTION IN HUMANS the majoratypicallymphocytesnonorgans https://med.libretexts.org/Courses/Skyline_College/Human_Physiology_for_Allied_Health_Professionals/13%3A_The_Lymphatic_and_Immune_System/13.05%3A_The_Adaptive_Immune_Response_-_B_Lymphocytes_and_Antibodies 13.5: The Adaptive Immune Response - B Lymphocytes and Antibodies - Medicine LibreTexts Jul 13, 2022 - Antibodies were the first component of the adaptive immune response to be characterized by scientists working on the immune system. It was already known that... immune responseadaptiveblymphocytesmedicine https://journals.uran.ua/sciencerise/article/view/37451 The effect of nitrogen oxide on the formation of chromosomal instability in human lymphocytes under... the effectnitrogen oxideformationinstabilityhuman https://www.gentaur.be/nl_BE/shop/0071-nvu16-uni-sep-maxi-plus-human-lymphocytes-filled-tubes-with-15-ml-medium-tube-18-tubes-box-4693 Uni-Sep Maxi Plus, Human Lymphocytes, Filled tubes with 15 ml medium-tube, 18 tubes/box | Gentaur... maxi plusunisephumanlymphocytes https://ricerca.unich.it/handle/11564/109239 Deregulation of the CD95/CD95L system in lymphocytes from patients with primary acute HIV infection hiv infectionderegulationsystemlymphocytespatients https://open.library.ubc.ca/soa/cIRcle/collections/facultyresearchandpublications/52383/items/1.0423911 Neither Tumor-Infiltrating Lymphocytes nor Cytotoxic T Cells Predict Enhanced Benefit from... Learning, knowledge, research, insight: welcome to the world of UBC Library, the second-largest academic research library in Canada. t cellsneithertumorlymphocytescytotoxic https://jhas-nu.in/smoking-genotoxicity-in-peripheral-blood-lymphocytes-using-the-comet-assay/ Smoking Genotoxicity In Peripheral Blood Lymphocytes Using The Comet Assay - Journal of Health and... the cometsmokinggenotoxicityperipheralblood https://www.cedarlanelabs.com/Products/Detail/CL5041?lob=Manufactured Lympholyte-Rat Cell Separation Media (Isolation of lymphocytes from Rat lymphoid tissue), liquid -... Cedarlane provides high quality research reagents for the life science community cell separation mediaisolationlymphocytestissueliquid https://actavet.vfu.cz/60/3/0231/ A Simple and Efficient Variant of the E Rosette Test for the Detection of T Lymphocytes in Pigs |... Acta Veterinaria Brunensis, the scientific journal of the University of Veterinary Sciences Brno, Czech Republic simpleefficientvariantrosettetest https://www.japsonline.com/abstract.php?article_id=3752&sts=2 Assessment of the genotoxicity and cytotoxicity of etazolate in cultured human lymphocytes Assessment of the genotoxicity and cytotoxicity of etazolate in cultured human lymphocytes assessmentgenotoxicitycytotoxicityculturedhuman https://scholars.uthscsa.edu/es/publications/fas-cd95-transduced-signal-preferentially-stimulates-lupus-periph/fingerprints/ Fas (CD95)-transduced signal preferentially stimulates lupus peripheral T lymphocytes - Huella -... fassignallupusperipherallymphocytes https://atcmeetingabstracts.com/abstract/the-inhibitory-effect-of-plasma-on-activation-of-lymphocytes-from-kidney-transplants-is-significantly-more-severe-in-tacrolimus-based-regimen-what-implications-for-plasma-exchange-role-in-anti-reject/ The Inhibitory Effect of Plasma on Activation of Lymphocytes from Kidney Transplants is... Background: Reduction of lymphocyte proliferation by human plasma has been previously reported. Reduced activation of lymphocytes of patients on... kidney transplantsinhibitoryeffectplasmaactivation https://ascopost.com/issues/july-10-2020/adoptive-cell-therapy-with-tumor-infiltrating-lymphocytes-proves-active-in-refractory-metastatic-melanoma/ Adoptive Cell Therapy With Tumor-Infiltrating Lymphocytes Proves Active in Refractory Metastatic... cell therapytumorlymphocytesprovesactive https://iris.uniupo.it/handle/11579/5181 Cytogenetic study on the circulating lymphocytes of rheumatoid arthritis patients treated with... on therheumatoid arthritisstudylymphocytespatients https://rusimmun.ru/jour/article/view/17127 Novel approach to cell cycle analysis of T lymphocytes using flow cytometry - Saidakova - Russian... Novel approach to cell cycle analysis of T lymphocytes using flow cytometry cell cycle analysisnovel approachflow cytometrylymphocytesusing https://researchconnect.buffalo.edu/en/publications/fibroblast-cytotoxicity-associated-with-plasma-cells-and-lymphocy/ Fibroblast cytotoxicity associated with plasma cells and lymphocytes in chronic periodontitis... associated withfibroblastcytotoxicityplasmacells https://cris.maastrichtuniversity.nl/en/publications/influence-of-vitamin-c-on-lymphocytes-an-overview/ Influence of Vitamin C on Lymphocytes: An Overview - Maastricht University of vitamin can overviewmaastricht universityinfluencelymphocytes https://samples.eduwriter.ai/965931592/immune-responses-t-lymphocytes-and-macrophages-in Immune Responses: T Lymphocytes and Macrophages in Eradication of Extracellular Pathogens Examples Essay sample on topic: Immune Responses: T Lymphocytes and Macrophages in Eradication of Extracellular Pathogens immune responseslymphocytesmacrophageseradicationextracellular https://www.alliedacademies.org/articles/during-antiviral-treatment-primary-lymphocytes-responses-support-lung-tissue-immune-function-23241.html During antiviral treatment, primary lymphocytes responses support lung tissue immune function. Natural lymphoid cells (ILCs), a heterogeneous cell populace, are basic in coordinating resistance and irritation in the digestive tract, however whether ILCs... antiviral treatmentimmune functionprimarylymphocytesresponses https://openstax.org/books/anatomy-and-physiology/pages/21-4-the-adaptive-immune-response-b-lymphocytes-and-antibodies 21.4 The Adaptive Immune Response: B-lymphocytes and Antibodies - Anatomy and Physiology | OpenStax B cells differentiate in the bone marrow. During the process of maturation, up to 100 trillion different clones of B cells are generated, which is simil... immune responseanatomy physiologyadaptiveblymphocytes https://www.spandidos-publications.com/or/31/1/391 DNA crosslinks, DNA damage and repair in peripheral blood lymphocytes of non-small cell lung cancer... Oncology Reports is an international journal devoted to fundamental and applied research in Oncology. small celllung cancerdnacrosslinksdamage https://www.jci.org/articles/view/111977 JCI - Differentiation and activation phenotypes of lung T lymphocytes differ from those of... jcidifferentiationactivationphenotypeslung